Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C2B4

Protein Details
Accession A0A0D0C2B4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-55VIPDSFGKRHRKRVYKKLHHSSPPSNHydrophilic
NLS Segment(s)
PositionSequence
37-43KRHRKRV
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MLSVCNHYIQGRAWRLLRLQSDLLSAGIAVIPDSFGKRHRKRVYKKLHHSSPPSNVSKMNQGKLVMSLLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.39
4 0.38
5 0.33
6 0.3
7 0.26
8 0.25
9 0.23
10 0.21
11 0.15
12 0.12
13 0.07
14 0.06
15 0.05
16 0.04
17 0.03
18 0.03
19 0.04
20 0.05
21 0.06
22 0.11
23 0.22
24 0.26
25 0.37
26 0.45
27 0.55
28 0.64
29 0.74
30 0.8
31 0.81
32 0.87
33 0.87
34 0.87
35 0.85
36 0.83
37 0.79
38 0.76
39 0.73
40 0.66
41 0.58
42 0.52
43 0.46
44 0.49
45 0.49
46 0.43
47 0.39
48 0.36
49 0.35
50 0.34
51 0.34