Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0CKV2

Protein Details
Accession A0A0D0CKV2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-71RETERERQTDRKRERQRERQRERVHYHCDYBasic
NLS Segment(s)
PositionSequence
52-59RKRERQRE
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MTTKVKHRMKTQGTVRMRTTSTEVIWFRIISSSPERERERERETERERQTDRKRERQRERQRERVHYHCDYDLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.66
3 0.6
4 0.54
5 0.46
6 0.42
7 0.35
8 0.29
9 0.3
10 0.28
11 0.26
12 0.26
13 0.24
14 0.19
15 0.18
16 0.17
17 0.13
18 0.17
19 0.2
20 0.21
21 0.28
22 0.29
23 0.31
24 0.36
25 0.38
26 0.39
27 0.41
28 0.43
29 0.47
30 0.5
31 0.57
32 0.56
33 0.57
34 0.56
35 0.58
36 0.63
37 0.64
38 0.67
39 0.69
40 0.75
41 0.79
42 0.87
43 0.88
44 0.9
45 0.91
46 0.92
47 0.92
48 0.9
49 0.9
50 0.87
51 0.84
52 0.81
53 0.75
54 0.7
55 0.63