Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BS04

Protein Details
Accession A0A0D0BS04    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
42-64LWQIQKQNCPRPYRRCWKVRLPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 8, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MFLARGFIAAFTLPFPPEAPAPAPVPAQDPSPPCSLSAHISLWQIQKQNCPRPYRRCWKVRLPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.11
5 0.13
6 0.13
7 0.14
8 0.15
9 0.16
10 0.15
11 0.14
12 0.16
13 0.15
14 0.15
15 0.16
16 0.16
17 0.18
18 0.19
19 0.19
20 0.17
21 0.18
22 0.17
23 0.16
24 0.17
25 0.16
26 0.16
27 0.17
28 0.2
29 0.22
30 0.24
31 0.26
32 0.25
33 0.33
34 0.4
35 0.49
36 0.52
37 0.58
38 0.64
39 0.68
40 0.77
41 0.79
42 0.8
43 0.8
44 0.81