Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BMC7

Protein Details
Accession A0A0D0BMC7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
50-69QPYKNKCKDCKQPCTQNQAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019367  PDZ-binding_CRIPT  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF10235  Cript  
Amino Acid Sequences MVCKKCEKKLSKVAAPDPFTSSSSSIKDGSRKVGENKLLGRPGSSKNRFQPYKNKCKDCKQPCTQNQAKYCHGCAYKKGLCSMCGKQILDTTGYVMSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.69
3 0.61
4 0.55
5 0.47
6 0.42
7 0.36
8 0.31
9 0.26
10 0.24
11 0.24
12 0.22
13 0.23
14 0.27
15 0.26
16 0.3
17 0.3
18 0.32
19 0.34
20 0.38
21 0.39
22 0.38
23 0.39
24 0.37
25 0.36
26 0.33
27 0.3
28 0.26
29 0.29
30 0.36
31 0.36
32 0.37
33 0.41
34 0.5
35 0.52
36 0.52
37 0.56
38 0.55
39 0.63
40 0.66
41 0.68
42 0.64
43 0.71
44 0.78
45 0.77
46 0.77
47 0.75
48 0.77
49 0.76
50 0.8
51 0.78
52 0.75
53 0.72
54 0.68
55 0.65
56 0.58
57 0.53
58 0.49
59 0.48
60 0.42
61 0.39
62 0.42
63 0.41
64 0.39
65 0.44
66 0.39
67 0.37
68 0.42
69 0.42
70 0.4
71 0.42
72 0.41
73 0.36
74 0.38
75 0.37
76 0.32
77 0.29
78 0.23
79 0.18