Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C810

Protein Details
Accession A0A0D0C810   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-55RPDNSKVESKTRRRNRGKLEKLHNLPBasic
NLS Segment(s)
PositionSequence
41-45RRRNR
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
PROSITE View protein in PROSITE  
PS50181  FBOX  
CDD cd09917  F-box_SF  
Amino Acid Sequences MRTRNSTKSTNNPTKLPHYDVTENFVEEERPDNSKVESKTRRRNRGKLEKLHNLPLDIVLEIYSYLEPLDILRLSRTSKDMRTFLMTRNNAIIWRKARLNVPDLPPLLEDISSEPQYASLVFESYCHVSDQFLVRRSKEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.6
4 0.53
5 0.49
6 0.51
7 0.48
8 0.48
9 0.41
10 0.36
11 0.31
12 0.27
13 0.21
14 0.15
15 0.18
16 0.14
17 0.16
18 0.17
19 0.17
20 0.19
21 0.24
22 0.27
23 0.33
24 0.41
25 0.48
26 0.57
27 0.67
28 0.75
29 0.78
30 0.85
31 0.85
32 0.87
33 0.87
34 0.86
35 0.84
36 0.83
37 0.77
38 0.76
39 0.66
40 0.55
41 0.45
42 0.36
43 0.28
44 0.18
45 0.14
46 0.07
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.05
57 0.04
58 0.05
59 0.05
60 0.07
61 0.08
62 0.09
63 0.13
64 0.15
65 0.18
66 0.23
67 0.23
68 0.24
69 0.28
70 0.29
71 0.3
72 0.36
73 0.33
74 0.3
75 0.3
76 0.29
77 0.26
78 0.27
79 0.29
80 0.22
81 0.25
82 0.26
83 0.27
84 0.31
85 0.32
86 0.35
87 0.35
88 0.36
89 0.39
90 0.37
91 0.35
92 0.31
93 0.28
94 0.25
95 0.18
96 0.15
97 0.13
98 0.17
99 0.17
100 0.17
101 0.15
102 0.15
103 0.15
104 0.15
105 0.13
106 0.09
107 0.09
108 0.08
109 0.09
110 0.12
111 0.14
112 0.15
113 0.14
114 0.14
115 0.14
116 0.17
117 0.24
118 0.28
119 0.32
120 0.36