Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0D436

Protein Details
Accession A0A0D0D436    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-59LLNRYWVKPRRNARRRDVCAVDKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 6, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016159  Cullin_repeat-like_dom_sf  
Amino Acid Sequences MEGKAAGLEDEDLFQYYAAEWDRYTTAADLLNRPFALLNRYWVKPRRNARRRDVCAVDKLALV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.09
5 0.1
6 0.1
7 0.09
8 0.1
9 0.11
10 0.11
11 0.12
12 0.1
13 0.09
14 0.11
15 0.12
16 0.13
17 0.14
18 0.15
19 0.14
20 0.13
21 0.13
22 0.11
23 0.13
24 0.11
25 0.16
26 0.19
27 0.21
28 0.27
29 0.34
30 0.39
31 0.45
32 0.55
33 0.6
34 0.65
35 0.73
36 0.77
37 0.81
38 0.83
39 0.83
40 0.81
41 0.75
42 0.72
43 0.67