Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0C4X1

Protein Details
Accession A0A0D0C4X1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-89SEEGSRPAKRHRRRSKEIERKFFCTWBasic
NLS Segment(s)
PositionSequence
69-80RPAKRHRRRSKE
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MRQLEVGNGNLSTDNESSCKERVTLRREIGGETEIVEAVGQRHSLRKHRSSSASGNMTSEQEISEEGSRPAKRHRRRSKEIERKFFCTWPGCEKGYGARASLYVHIKLKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.18
5 0.19
6 0.19
7 0.17
8 0.24
9 0.31
10 0.35
11 0.42
12 0.41
13 0.45
14 0.45
15 0.44
16 0.39
17 0.31
18 0.25
19 0.18
20 0.16
21 0.1
22 0.09
23 0.08
24 0.06
25 0.06
26 0.07
27 0.06
28 0.06
29 0.11
30 0.15
31 0.23
32 0.3
33 0.35
34 0.39
35 0.43
36 0.47
37 0.48
38 0.49
39 0.48
40 0.44
41 0.38
42 0.34
43 0.3
44 0.26
45 0.21
46 0.17
47 0.1
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.09
54 0.15
55 0.16
56 0.17
57 0.27
58 0.36
59 0.44
60 0.54
61 0.65
62 0.69
63 0.77
64 0.87
65 0.89
66 0.9
67 0.91
68 0.9
69 0.84
70 0.81
71 0.75
72 0.67
73 0.61
74 0.55
75 0.48
76 0.45
77 0.45
78 0.4
79 0.37
80 0.36
81 0.36
82 0.37
83 0.34
84 0.28
85 0.23
86 0.23
87 0.24
88 0.29
89 0.27
90 0.25