Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BYE6

Protein Details
Accession A0A0D0BYE6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTVKRGRKRKQYNAAINCGPRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 6, mito_nucl 6, golg 3
Family & Domain DBs
Amino Acid Sequences MTVKRGRKRKQYNAAINCGPRKECAVDAMALAVLVFGLLSDVVDANTSTNTSTNTGANTNTDTSMSTDTDTGTGKSTTALSCDSTINSLILDILIRFQELGTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.77
4 0.7
5 0.63
6 0.53
7 0.43
8 0.39
9 0.34
10 0.28
11 0.24
12 0.22
13 0.19
14 0.18
15 0.17
16 0.13
17 0.1
18 0.09
19 0.06
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.06
38 0.08
39 0.09
40 0.09
41 0.1
42 0.11
43 0.11
44 0.11
45 0.12
46 0.11
47 0.1
48 0.1
49 0.09
50 0.1
51 0.12
52 0.11
53 0.1
54 0.1
55 0.1
56 0.11
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.1
63 0.11
64 0.1
65 0.11
66 0.12
67 0.12
68 0.13
69 0.14
70 0.14
71 0.14
72 0.15
73 0.13
74 0.11
75 0.1
76 0.08
77 0.08
78 0.08
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07