Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CKP8

Protein Details
Accession A0A0D0CKP8   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
138-157DYRDRDRDRRWDDKDRDRDYAcidic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MFIRFTALTMRHFLLECLGTSAWHPIDQENSDANARISIPTDDFSGSTGAIPSGPEALRRSRSRSPEEADNPGNNVHVSGLSHKVDSRDLETSTEEAEVSITAHNGAELMGKVITIAKPYDSRYSRDFPDCRGGRYDDYRDRDRDRRWDDKDRDRDYYRERKCECGDRYDRYDRHDDRCDRYDDRSRRLSWVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.18
4 0.18
5 0.16
6 0.14
7 0.15
8 0.2
9 0.17
10 0.17
11 0.17
12 0.15
13 0.2
14 0.21
15 0.23
16 0.2
17 0.22
18 0.21
19 0.22
20 0.2
21 0.17
22 0.16
23 0.14
24 0.13
25 0.13
26 0.13
27 0.13
28 0.14
29 0.14
30 0.13
31 0.13
32 0.12
33 0.1
34 0.09
35 0.09
36 0.07
37 0.07
38 0.07
39 0.06
40 0.09
41 0.09
42 0.11
43 0.13
44 0.18
45 0.25
46 0.28
47 0.34
48 0.38
49 0.45
50 0.48
51 0.52
52 0.51
53 0.53
54 0.54
55 0.53
56 0.49
57 0.43
58 0.38
59 0.33
60 0.29
61 0.19
62 0.16
63 0.1
64 0.07
65 0.07
66 0.08
67 0.12
68 0.12
69 0.12
70 0.13
71 0.14
72 0.15
73 0.16
74 0.16
75 0.14
76 0.14
77 0.15
78 0.15
79 0.14
80 0.13
81 0.12
82 0.09
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.04
98 0.04
99 0.04
100 0.06
101 0.06
102 0.06
103 0.07
104 0.08
105 0.1
106 0.13
107 0.21
108 0.22
109 0.25
110 0.29
111 0.32
112 0.34
113 0.4
114 0.39
115 0.34
116 0.43
117 0.4
118 0.38
119 0.38
120 0.37
121 0.34
122 0.38
123 0.43
124 0.4
125 0.45
126 0.49
127 0.5
128 0.54
129 0.57
130 0.57
131 0.6
132 0.59
133 0.63
134 0.65
135 0.71
136 0.73
137 0.76
138 0.8
139 0.75
140 0.75
141 0.69
142 0.68
143 0.67
144 0.69
145 0.66
146 0.65
147 0.62
148 0.62
149 0.65
150 0.68
151 0.62
152 0.62
153 0.62
154 0.59
155 0.65
156 0.67
157 0.64
158 0.6
159 0.66
160 0.61
161 0.61
162 0.64
163 0.62
164 0.6
165 0.63
166 0.64
167 0.57
168 0.6
169 0.63
170 0.61
171 0.62
172 0.63
173 0.59