Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C9Y5

Protein Details
Accession A0A0D0C9Y5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-80FSIPPTRRTRTCRRRHTPLQLSTRPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MCHQRTLSPKPSAATGRHPLHEEAESDPCTQRTPTHTFGTSVPHINTPNNDLPVFSIPPTRRTRTCRRRHTPLQLSTRPQRPPRLPSLIRPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.45
4 0.45
5 0.46
6 0.42
7 0.39
8 0.37
9 0.3
10 0.24
11 0.25
12 0.24
13 0.23
14 0.23
15 0.21
16 0.2
17 0.2
18 0.19
19 0.2
20 0.25
21 0.27
22 0.3
23 0.3
24 0.3
25 0.3
26 0.33
27 0.29
28 0.25
29 0.22
30 0.2
31 0.21
32 0.2
33 0.2
34 0.2
35 0.2
36 0.2
37 0.19
38 0.16
39 0.17
40 0.19
41 0.19
42 0.14
43 0.18
44 0.17
45 0.25
46 0.31
47 0.34
48 0.37
49 0.44
50 0.55
51 0.6
52 0.69
53 0.73
54 0.76
55 0.81
56 0.85
57 0.88
58 0.87
59 0.86
60 0.85
61 0.81
62 0.8
63 0.78
64 0.76
65 0.74
66 0.71
67 0.71
68 0.69
69 0.69
70 0.7
71 0.72
72 0.68