Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C2T4

Protein Details
Accession A0A0D0C2T4    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-34YGCGEGSRKKLHKRYHASRGRNLKEBasic
NLS Segment(s)
PositionSequence
19-19K
21-22HK
76-80KERKK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MARCTEGRVYGCGEGSRKKLHKRYHASRGRNLKEQDQPHYRTRVKEGEQAVEFSTDGERAEILKKFKEAMRGESVKERKKKLTETAELVTYGTEVLDGEEGSQREGSGPSNVSPPALDQAGQDTKETSDPEASERLFERDLELAKRLSLYEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.39
4 0.43
5 0.51
6 0.58
7 0.64
8 0.71
9 0.76
10 0.81
11 0.83
12 0.85
13 0.83
14 0.83
15 0.84
16 0.79
17 0.77
18 0.71
19 0.67
20 0.65
21 0.62
22 0.62
23 0.59
24 0.59
25 0.56
26 0.62
27 0.58
28 0.53
29 0.54
30 0.53
31 0.48
32 0.5
33 0.47
34 0.44
35 0.41
36 0.39
37 0.34
38 0.26
39 0.23
40 0.16
41 0.14
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.09
48 0.12
49 0.13
50 0.14
51 0.15
52 0.17
53 0.18
54 0.26
55 0.24
56 0.26
57 0.31
58 0.31
59 0.32
60 0.38
61 0.43
62 0.42
63 0.46
64 0.44
65 0.43
66 0.45
67 0.48
68 0.49
69 0.5
70 0.47
71 0.46
72 0.44
73 0.4
74 0.36
75 0.31
76 0.23
77 0.15
78 0.1
79 0.06
80 0.04
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.07
87 0.08
88 0.09
89 0.09
90 0.08
91 0.09
92 0.1
93 0.11
94 0.1
95 0.12
96 0.12
97 0.14
98 0.15
99 0.14
100 0.13
101 0.13
102 0.13
103 0.12
104 0.12
105 0.09
106 0.16
107 0.2
108 0.2
109 0.2
110 0.18
111 0.19
112 0.21
113 0.22
114 0.18
115 0.17
116 0.17
117 0.2
118 0.23
119 0.22
120 0.22
121 0.22
122 0.24
123 0.22
124 0.21
125 0.21
126 0.21
127 0.24
128 0.24
129 0.26
130 0.23
131 0.22
132 0.23