Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BPZ2

Protein Details
Accession A0A0D0BPZ2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-101VWNVCCSHPKPTQKPPRIIECHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MAFFGRVLSWSIYTCFSKPVVFASRTVAVPKFSTSLQQMASAAKKSQRRNYTVQHITMKIWNKNGAANFICNHRTTTREIVWNVCCSHPKPTQKPPRIIEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.19
5 0.18
6 0.22
7 0.25
8 0.24
9 0.24
10 0.26
11 0.28
12 0.28
13 0.3
14 0.26
15 0.21
16 0.21
17 0.21
18 0.18
19 0.15
20 0.17
21 0.16
22 0.18
23 0.16
24 0.16
25 0.16
26 0.17
27 0.18
28 0.17
29 0.16
30 0.19
31 0.25
32 0.3
33 0.37
34 0.41
35 0.44
36 0.48
37 0.52
38 0.57
39 0.54
40 0.52
41 0.48
42 0.43
43 0.39
44 0.38
45 0.38
46 0.32
47 0.3
48 0.29
49 0.26
50 0.28
51 0.27
52 0.27
53 0.23
54 0.22
55 0.21
56 0.22
57 0.23
58 0.21
59 0.23
60 0.2
61 0.21
62 0.24
63 0.3
64 0.3
65 0.34
66 0.35
67 0.38
68 0.39
69 0.41
70 0.38
71 0.34
72 0.35
73 0.31
74 0.37
75 0.4
76 0.47
77 0.52
78 0.61
79 0.69
80 0.74
81 0.82