Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BZN4

Protein Details
Accession A0A0D0BZN4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-40VVQWYLRREWRWRQRPCRHRHCHRQCVFGIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 9, plas 5, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQRMLVGVMKVVQWYLRREWRWRQRPCRHRHCHRQCVFGILIIILIVIVILTVVVVVWSGSGSELEGGGNNDNTLLPASINGILRDDEQGNRKQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.33
4 0.37
5 0.44
6 0.55
7 0.63
8 0.69
9 0.76
10 0.8
11 0.82
12 0.87
13 0.91
14 0.91
15 0.91
16 0.91
17 0.92
18 0.91
19 0.92
20 0.86
21 0.82
22 0.71
23 0.65
24 0.55
25 0.44
26 0.33
27 0.22
28 0.17
29 0.1
30 0.09
31 0.04
32 0.03
33 0.02
34 0.02
35 0.01
36 0.01
37 0.01
38 0.01
39 0.01
40 0.01
41 0.01
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.05
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.07
63 0.06
64 0.06
65 0.08
66 0.11
67 0.13
68 0.13
69 0.13
70 0.14
71 0.15
72 0.18
73 0.18
74 0.2
75 0.24