Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BG57

Protein Details
Accession A0A0D0BG57   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-138QGNASKKSRDKAKKAGKKARGKAKSSKFVVHydrophilic
NLS Segment(s)
PositionSequence
80-133RKKSKMSGKATKRLTKASRDSQGQAANRLQGNASKKSRDKAKKAGKKARGKAKS
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, cyto 3
Family & Domain DBs
Amino Acid Sequences MSASKHKSYIQEMEKAGKLDPKEQQQCSDVGKTHKKCCPENNEDGVDSKELDSNVKKSGKHGTKCCPQDNSDEELESSARKKSKMSGKATKRLTKASRDSQGQAANRLQGNASKKSRDKAKKAGKKARGKAKSSKFVVDSNAEDSPSNFSDSEEEEAEMTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.4
4 0.35
5 0.32
6 0.31
7 0.35
8 0.4
9 0.46
10 0.47
11 0.49
12 0.46
13 0.47
14 0.45
15 0.43
16 0.37
17 0.37
18 0.45
19 0.48
20 0.54
21 0.55
22 0.56
23 0.58
24 0.63
25 0.64
26 0.62
27 0.63
28 0.61
29 0.6
30 0.54
31 0.5
32 0.42
33 0.33
34 0.26
35 0.18
36 0.15
37 0.12
38 0.15
39 0.15
40 0.16
41 0.21
42 0.24
43 0.24
44 0.24
45 0.34
46 0.4
47 0.44
48 0.49
49 0.51
50 0.56
51 0.62
52 0.64
53 0.57
54 0.5
55 0.49
56 0.46
57 0.42
58 0.34
59 0.28
60 0.24
61 0.21
62 0.2
63 0.14
64 0.12
65 0.11
66 0.12
67 0.12
68 0.13
69 0.18
70 0.27
71 0.35
72 0.42
73 0.49
74 0.55
75 0.63
76 0.69
77 0.69
78 0.63
79 0.62
80 0.58
81 0.56
82 0.55
83 0.54
84 0.53
85 0.5
86 0.5
87 0.46
88 0.48
89 0.42
90 0.39
91 0.33
92 0.3
93 0.27
94 0.26
95 0.22
96 0.2
97 0.24
98 0.28
99 0.3
100 0.33
101 0.36
102 0.41
103 0.51
104 0.57
105 0.6
106 0.62
107 0.7
108 0.73
109 0.81
110 0.86
111 0.85
112 0.86
113 0.87
114 0.88
115 0.85
116 0.82
117 0.81
118 0.81
119 0.8
120 0.73
121 0.7
122 0.62
123 0.56
124 0.54
125 0.48
126 0.41
127 0.35
128 0.33
129 0.28
130 0.25
131 0.23
132 0.24
133 0.21
134 0.22
135 0.17
136 0.17
137 0.19
138 0.21
139 0.24
140 0.2
141 0.19