Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C409

Protein Details
Accession A0A0D0C409   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
52-77FGGTSWKCWQKKKRGSCYLRSRYDCWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 5, extr 5, plas 2
Family & Domain DBs
Amino Acid Sequences MPCQIISDIILCSLLPLRPTTTAKEQPYRRATKYDQCLNCNPHNGVCRFNGFGGTSWKCWQKKKRGSCYLRSRYDCWAQLPQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.13
5 0.17
6 0.2
7 0.24
8 0.3
9 0.37
10 0.42
11 0.49
12 0.51
13 0.55
14 0.62
15 0.64
16 0.57
17 0.56
18 0.55
19 0.55
20 0.59
21 0.58
22 0.54
23 0.52
24 0.55
25 0.55
26 0.52
27 0.47
28 0.4
29 0.34
30 0.35
31 0.32
32 0.29
33 0.25
34 0.24
35 0.22
36 0.21
37 0.19
38 0.15
39 0.16
40 0.2
41 0.21
42 0.21
43 0.24
44 0.32
45 0.34
46 0.43
47 0.5
48 0.54
49 0.62
50 0.71
51 0.78
52 0.81
53 0.85
54 0.86
55 0.88
56 0.87
57 0.87
58 0.82
59 0.74
60 0.7
61 0.71
62 0.64
63 0.58