Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0CIC8

Protein Details
Accession A0A0D0CIC8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-82LTGGCLRKRKGRKSESDAGHBasic
NLS Segment(s)
PositionSequence
71-72RK
Subcellular Location(s) extr 14, plas 8, vacu 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGVVVSCILGTISVIALSLLCLIETIVGCLVLVLKLAFACLECVIVGTGLGLFAAAQGLAYVLTGGCLRKRKGRKSESDAGHSLQVVKVSPTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.06
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.04
19 0.04
20 0.03
21 0.04
22 0.03
23 0.04
24 0.04
25 0.04
26 0.05
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.03
51 0.04
52 0.06
53 0.1
54 0.16
55 0.19
56 0.28
57 0.38
58 0.47
59 0.57
60 0.66
61 0.72
62 0.75
63 0.82
64 0.79
65 0.77
66 0.7
67 0.61
68 0.53
69 0.44
70 0.36
71 0.28
72 0.23
73 0.17