Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CA11

Protein Details
Accession A0A0D0CA11    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MDWSKCGKQCKRSNFKKSRYRVKSIEKGLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 9, E.R. 3, nucl 2, golg 2
Family & Domain DBs
Amino Acid Sequences MDWSKCGKQCKRSNFKKSRYRVKSIEKGLVFRSSLLCIALSPVFFSCREERPTDVLYRVLILSAILSNRLVRPWHDSRLYGMARRFGEFSAQPYTTRSWINPVQVNPILI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.9
4 0.91
5 0.91
6 0.88
7 0.85
8 0.83
9 0.82
10 0.81
11 0.77
12 0.76
13 0.66
14 0.6
15 0.54
16 0.49
17 0.39
18 0.31
19 0.26
20 0.19
21 0.17
22 0.15
23 0.12
24 0.09
25 0.1
26 0.1
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.13
33 0.14
34 0.17
35 0.2
36 0.21
37 0.22
38 0.25
39 0.27
40 0.25
41 0.23
42 0.2
43 0.17
44 0.15
45 0.13
46 0.09
47 0.07
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.09
57 0.09
58 0.1
59 0.18
60 0.22
61 0.27
62 0.29
63 0.29
64 0.3
65 0.37
66 0.38
67 0.35
68 0.33
69 0.34
70 0.33
71 0.33
72 0.31
73 0.24
74 0.27
75 0.23
76 0.24
77 0.24
78 0.24
79 0.23
80 0.25
81 0.28
82 0.26
83 0.27
84 0.25
85 0.26
86 0.29
87 0.36
88 0.39
89 0.38
90 0.43