Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0ALV7

Protein Details
Accession A0A0D0ALV7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-38VFRQLPYLRREQQRRERLYRHRYFQRQCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 4, E.R. 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGSGVRVTTVFRQLPYLRREQQRRERLYRHRYFQRQCIFGVGNTIISIIVIISPSLSSSGSGICDYNPLSSLSADSSPNHIKPSPISPSHSEPSPVTAPLPDSVFPSSTPTPTPPTHPYLLPQLHRLPFLRLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.42
4 0.47
5 0.48
6 0.56
7 0.64
8 0.68
9 0.75
10 0.78
11 0.81
12 0.81
13 0.82
14 0.83
15 0.85
16 0.83
17 0.81
18 0.81
19 0.82
20 0.79
21 0.79
22 0.76
23 0.67
24 0.59
25 0.55
26 0.46
27 0.36
28 0.34
29 0.25
30 0.17
31 0.15
32 0.15
33 0.09
34 0.08
35 0.08
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.1
63 0.1
64 0.14
65 0.16
66 0.17
67 0.19
68 0.18
69 0.18
70 0.19
71 0.24
72 0.25
73 0.25
74 0.28
75 0.3
76 0.35
77 0.36
78 0.35
79 0.32
80 0.26
81 0.29
82 0.27
83 0.23
84 0.18
85 0.16
86 0.17
87 0.16
88 0.18
89 0.13
90 0.14
91 0.15
92 0.16
93 0.15
94 0.2
95 0.2
96 0.2
97 0.21
98 0.22
99 0.26
100 0.27
101 0.33
102 0.32
103 0.36
104 0.37
105 0.36
106 0.36
107 0.4
108 0.46
109 0.43
110 0.44
111 0.45
112 0.45
113 0.48
114 0.47