Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CJF7

Protein Details
Accession A0A0D0CJF7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGLRKRFRRKLNSRKWKAPISIHydrophilic
NLS Segment(s)
PositionSequence
4-17RKRFRRKLNSRKWK
Subcellular Location(s) plas 15, mito 6, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGLRKRFRRKLNSRKWKAPISIYYHTGSQKSISSYRVKRPACVHIDATKSISLNTYNVYLSVIYIYAMCDLFVYYIRRFRFPVSVLCFNSCLWVVLWALEGFANSFTRMCLLFISTECY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.86
4 0.8
5 0.76
6 0.72
7 0.69
8 0.64
9 0.58
10 0.52
11 0.47
12 0.44
13 0.37
14 0.3
15 0.24
16 0.21
17 0.22
18 0.23
19 0.23
20 0.3
21 0.35
22 0.43
23 0.5
24 0.48
25 0.49
26 0.51
27 0.55
28 0.51
29 0.49
30 0.44
31 0.39
32 0.41
33 0.37
34 0.35
35 0.27
36 0.23
37 0.19
38 0.17
39 0.12
40 0.1
41 0.1
42 0.1
43 0.08
44 0.08
45 0.08
46 0.07
47 0.06
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.05
59 0.07
60 0.11
61 0.11
62 0.17
63 0.18
64 0.2
65 0.22
66 0.23
67 0.26
68 0.25
69 0.31
70 0.33
71 0.39
72 0.39
73 0.4
74 0.39
75 0.34
76 0.34
77 0.26
78 0.2
79 0.12
80 0.12
81 0.11
82 0.1
83 0.12
84 0.09
85 0.1
86 0.09
87 0.08
88 0.07
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.1
95 0.11
96 0.11
97 0.1
98 0.11
99 0.12