Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BFE3

Protein Details
Accession A0A0D0BFE3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSKRGRKRNDNLPPNRARDVHydrophilic
NLS Segment(s)
PositionSequence
7-8RK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSSKRGRKRNDNLPPNRARDVQRAFRARRAAHLQALEQRVTELEEENTCLRQALNLPPANRPVLGKGPTGKDKPKTFDSPGLTPSIIESRDSSGSPPSTRLGSYSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.75
4 0.69
5 0.63
6 0.62
7 0.61
8 0.6
9 0.61
10 0.64
11 0.62
12 0.63
13 0.66
14 0.57
15 0.56
16 0.55
17 0.49
18 0.45
19 0.43
20 0.4
21 0.38
22 0.4
23 0.33
24 0.26
25 0.22
26 0.18
27 0.17
28 0.15
29 0.09
30 0.08
31 0.08
32 0.1
33 0.11
34 0.11
35 0.1
36 0.09
37 0.08
38 0.08
39 0.1
40 0.12
41 0.18
42 0.21
43 0.22
44 0.23
45 0.26
46 0.26
47 0.24
48 0.2
49 0.16
50 0.19
51 0.2
52 0.21
53 0.22
54 0.26
55 0.32
56 0.36
57 0.39
58 0.41
59 0.43
60 0.46
61 0.49
62 0.51
63 0.49
64 0.52
65 0.52
66 0.47
67 0.44
68 0.42
69 0.35
70 0.29
71 0.27
72 0.24
73 0.19
74 0.17
75 0.17
76 0.18
77 0.2
78 0.2
79 0.19
80 0.21
81 0.24
82 0.25
83 0.26
84 0.24
85 0.25
86 0.25