Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CEP9

Protein Details
Accession A0A0D0CEP9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-47PKIPLSPKERSRRFRARQKQKNSNNLQQTHydrophilic
NLS Segment(s)
PositionSequence
25-38PKERSRRFRARQKQ
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MQPEPWPDFYEGVRAQTGPKIPLSPKERSRRFRARQKQKNSNNLQQTAQKVQKKRQKFGQKIEFEPAQPRSVELPQQPMTSQSTFTFEVITPLTMNQIFSTSRTDNTPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.25
4 0.27
5 0.21
6 0.22
7 0.23
8 0.24
9 0.32
10 0.36
11 0.4
12 0.46
13 0.55
14 0.63
15 0.65
16 0.73
17 0.75
18 0.8
19 0.82
20 0.84
21 0.85
22 0.86
23 0.9
24 0.91
25 0.89
26 0.9
27 0.86
28 0.83
29 0.79
30 0.71
31 0.63
32 0.57
33 0.51
34 0.47
35 0.47
36 0.43
37 0.4
38 0.46
39 0.51
40 0.54
41 0.54
42 0.57
43 0.61
44 0.63
45 0.69
46 0.7
47 0.67
48 0.63
49 0.63
50 0.55
51 0.45
52 0.43
53 0.35
54 0.27
55 0.23
56 0.22
57 0.2
58 0.21
59 0.24
60 0.21
61 0.26
62 0.26
63 0.27
64 0.26
65 0.25
66 0.28
67 0.24
68 0.24
69 0.18
70 0.2
71 0.2
72 0.2
73 0.2
74 0.16
75 0.17
76 0.16
77 0.16
78 0.12
79 0.11
80 0.15
81 0.13
82 0.14
83 0.12
84 0.13
85 0.13
86 0.15
87 0.21
88 0.2
89 0.21