Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C7S1

Protein Details
Accession A0A0D0C7S1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-94TPEIICQRRKARQAKNSKDLSAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFASSVMGFWAFLAFAVCSLPRQLVIVYTNVLFEDEANGTSTKIEFTPVTVAFAIIILITYYGYLLKEMKRVTPEIICQRRKARQAKNSKDLSAVESPAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.08
6 0.09
7 0.09
8 0.08
9 0.09
10 0.09
11 0.1
12 0.12
13 0.12
14 0.12
15 0.12
16 0.12
17 0.11
18 0.11
19 0.08
20 0.07
21 0.08
22 0.07
23 0.07
24 0.09
25 0.09
26 0.08
27 0.09
28 0.09
29 0.07
30 0.07
31 0.08
32 0.06
33 0.07
34 0.11
35 0.11
36 0.12
37 0.11
38 0.11
39 0.09
40 0.09
41 0.08
42 0.04
43 0.04
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.05
52 0.07
53 0.08
54 0.12
55 0.13
56 0.16
57 0.19
58 0.21
59 0.22
60 0.23
61 0.29
62 0.36
63 0.45
64 0.45
65 0.49
66 0.55
67 0.6
68 0.67
69 0.7
70 0.69
71 0.7
72 0.77
73 0.81
74 0.83
75 0.81
76 0.73
77 0.68
78 0.59
79 0.54
80 0.47
81 0.39