Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C6W3

Protein Details
Accession A0A0D0C6W3   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAKHNKSQGQGNNKPKRKRDRFLDLFKFNHydrophilic
NLS Segment(s)
PositionSequence
15-18PKRK
Subcellular Location(s) nucl 18, cyto_nucl 13.333, cyto 6.5, cyto_mito 4.666
Family & Domain DBs
Amino Acid Sequences MAKHNKSQGQGNNKPKRKRDRFLDLFKFNLQGSRSPTLSSASSAGIGTNVEGMTEGNISDLAYGPGGMLIVVYDHDPKIDFLHLFLCRHFVSCFWYDLFLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.86
4 0.86
5 0.85
6 0.83
7 0.83
8 0.84
9 0.86
10 0.86
11 0.78
12 0.71
13 0.63
14 0.55
15 0.44
16 0.39
17 0.3
18 0.24
19 0.26
20 0.26
21 0.25
22 0.24
23 0.24
24 0.23
25 0.22
26 0.19
27 0.14
28 0.11
29 0.11
30 0.11
31 0.1
32 0.08
33 0.07
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.02
57 0.03
58 0.03
59 0.04
60 0.06
61 0.06
62 0.06
63 0.07
64 0.08
65 0.1
66 0.13
67 0.12
68 0.11
69 0.17
70 0.2
71 0.21
72 0.2
73 0.23
74 0.2
75 0.22
76 0.22
77 0.17
78 0.2
79 0.21
80 0.23
81 0.2
82 0.23