Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C2Y0

Protein Details
Accession A0A0D0C2Y0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-40SGECFKCRKYHRRSDACRGRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12.5, cyto 8, mito 5
Family & Domain DBs
Amino Acid Sequences MQLSEKTAMPLEPGTVPVCSGECFKCRKYHRRSDACRGRAIPRVEEGHSIHSVTKEYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.11
5 0.11
6 0.1
7 0.12
8 0.13
9 0.15
10 0.19
11 0.21
12 0.29
13 0.36
14 0.45
15 0.51
16 0.6
17 0.66
18 0.73
19 0.78
20 0.81
21 0.83
22 0.76
23 0.73
24 0.65
25 0.59
26 0.56
27 0.51
28 0.43
29 0.37
30 0.38
31 0.34
32 0.36
33 0.34
34 0.31
35 0.3
36 0.29
37 0.25
38 0.23