Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0B4F1

Protein Details
Accession A0A0D0B4F1   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
83-114VRVRSREGRRNRAPPPRIRWKDNKKVNPAVAAHydrophilic
NLS Segment(s)
PositionSequence
2-14KKRRNGGRNKKGR
86-107RSREGRRNRAPPPRIRWKDNKK
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences TKKRRNGGRNKKGRGHVSFMRCSNCSRCVAKDKAIKRFTVRNMVESAAVRDISEASVYSEYVVPKLYIKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRIRWKDNKKVNPAVAAAEDAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.73
4 0.7
5 0.67
6 0.63
7 0.59
8 0.51
9 0.5
10 0.47
11 0.43
12 0.41
13 0.37
14 0.38
15 0.42
16 0.45
17 0.49
18 0.52
19 0.54
20 0.59
21 0.59
22 0.56
23 0.52
24 0.55
25 0.52
26 0.54
27 0.48
28 0.4
29 0.39
30 0.37
31 0.34
32 0.27
33 0.24
34 0.15
35 0.14
36 0.11
37 0.1
38 0.09
39 0.08
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.08
52 0.08
53 0.09
54 0.09
55 0.1
56 0.12
57 0.14
58 0.14
59 0.14
60 0.14
61 0.14
62 0.13
63 0.13
64 0.14
65 0.19
66 0.18
67 0.21
68 0.24
69 0.29
70 0.3
71 0.32
72 0.35
73 0.37
74 0.44
75 0.49
76 0.56
77 0.61
78 0.68
79 0.73
80 0.76
81 0.78
82 0.8
83 0.8
84 0.8
85 0.81
86 0.79
87 0.79
88 0.81
89 0.81
90 0.84
91 0.85
92 0.85
93 0.83
94 0.85
95 0.8
96 0.74
97 0.64
98 0.56
99 0.47