Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CPQ0

Protein Details
Accession A0A0D0CPQ0   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
208-236TEWPGNAKKKTKTKESEKDKKREKEAEEEBasic
NLS Segment(s)
PositionSequence
214-231AKKKTKTKESEKDKKREK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MGPIRSSKRRSLPEPSETLPGIQKIKASIRQTKRLLAKEKLTADVRVTAERKLKSLEADLAKAETNRKEKTLSIRYHKVKFFERQKVTRKINQTKRKISQLQEEDEGSSSAITVLEKELYEHRVELNYILHYPKTKKYISLFPPEVRHKSDTSDNTNAPETKETDQQRQEIKQWIREQMSAGSLPAEPEDVEQSPEQKPTPMNSKSGTEWPGNAKKKTKTKESEKDKKREKEAEEEEEDDFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.65
3 0.6
4 0.52
5 0.49
6 0.42
7 0.38
8 0.33
9 0.28
10 0.26
11 0.26
12 0.32
13 0.37
14 0.41
15 0.46
16 0.52
17 0.6
18 0.62
19 0.66
20 0.68
21 0.68
22 0.69
23 0.66
24 0.63
25 0.61
26 0.6
27 0.58
28 0.52
29 0.45
30 0.39
31 0.38
32 0.34
33 0.33
34 0.32
35 0.31
36 0.35
37 0.34
38 0.34
39 0.31
40 0.31
41 0.27
42 0.29
43 0.31
44 0.27
45 0.27
46 0.26
47 0.24
48 0.23
49 0.22
50 0.24
51 0.23
52 0.27
53 0.27
54 0.28
55 0.29
56 0.31
57 0.39
58 0.45
59 0.46
60 0.48
61 0.56
62 0.6
63 0.65
64 0.65
65 0.6
66 0.57
67 0.58
68 0.6
69 0.6
70 0.62
71 0.63
72 0.69
73 0.74
74 0.75
75 0.72
76 0.73
77 0.73
78 0.76
79 0.78
80 0.78
81 0.78
82 0.76
83 0.79
84 0.75
85 0.68
86 0.67
87 0.62
88 0.55
89 0.48
90 0.43
91 0.35
92 0.29
93 0.26
94 0.16
95 0.1
96 0.07
97 0.05
98 0.05
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.06
105 0.07
106 0.09
107 0.09
108 0.09
109 0.09
110 0.09
111 0.1
112 0.1
113 0.09
114 0.08
115 0.09
116 0.1
117 0.1
118 0.12
119 0.15
120 0.18
121 0.22
122 0.22
123 0.25
124 0.28
125 0.36
126 0.38
127 0.45
128 0.44
129 0.42
130 0.49
131 0.5
132 0.5
133 0.45
134 0.42
135 0.34
136 0.34
137 0.38
138 0.36
139 0.38
140 0.39
141 0.36
142 0.36
143 0.38
144 0.35
145 0.29
146 0.26
147 0.22
148 0.2
149 0.27
150 0.28
151 0.33
152 0.35
153 0.39
154 0.42
155 0.41
156 0.43
157 0.45
158 0.45
159 0.45
160 0.46
161 0.48
162 0.45
163 0.44
164 0.41
165 0.33
166 0.33
167 0.25
168 0.21
169 0.15
170 0.13
171 0.12
172 0.11
173 0.1
174 0.07
175 0.08
176 0.11
177 0.1
178 0.13
179 0.13
180 0.16
181 0.17
182 0.2
183 0.19
184 0.19
185 0.21
186 0.24
187 0.32
188 0.32
189 0.34
190 0.34
191 0.37
192 0.38
193 0.42
194 0.41
195 0.33
196 0.33
197 0.38
198 0.45
199 0.49
200 0.52
201 0.54
202 0.59
203 0.68
204 0.73
205 0.74
206 0.75
207 0.78
208 0.82
209 0.86
210 0.87
211 0.88
212 0.91
213 0.91
214 0.89
215 0.88
216 0.86
217 0.8
218 0.8
219 0.78
220 0.75
221 0.7
222 0.63
223 0.54