Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2S855

Protein Details
Accession A0A0H2S855    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSTSSKRGRKRNDNLPPNRARDHydrophilic
NLS Segment(s)
PositionSequence
8-11GRKR
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSTSSKRGRKRNDNLPPNRARDVQRAFRARRAAHLQELEKRVTELEEENENLRVALSLPPANRVPLGHGPTGRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.84
4 0.79
5 0.73
6 0.67
7 0.6
8 0.59
9 0.58
10 0.56
11 0.57
12 0.6
13 0.58
14 0.59
15 0.61
16 0.52
17 0.51
18 0.5
19 0.44
20 0.4
21 0.42
22 0.39
23 0.38
24 0.4
25 0.34
26 0.27
27 0.24
28 0.2
29 0.16
30 0.15
31 0.1
32 0.1
33 0.12
34 0.13
35 0.14
36 0.15
37 0.14
38 0.13
39 0.11
40 0.09
41 0.08
42 0.09
43 0.12
44 0.14
45 0.15
46 0.19
47 0.2
48 0.21
49 0.21
50 0.19
51 0.22
52 0.27
53 0.31
54 0.32
55 0.33