Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2S0W5

Protein Details
Accession A0A0H2S0W5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPQPSAAARRRGPBasic
NLS Segment(s)
PositionSequence
3-21KRKKSSRKPQPSAAARRRG
Subcellular Location(s) nucl 11.5, mito_nucl 11.5, mito 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPQPSAAARRRGPLDTRFRCIFCFNENAVSVKVSKAEGTATLNCERCFEKFEATAHHLTEPVDVYNWWKDAVEEAQPKAAPRRPSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.85
4 0.75
5 0.73
6 0.67
7 0.6
8 0.55
9 0.52
10 0.54
11 0.49
12 0.54
13 0.52
14 0.49
15 0.48
16 0.45
17 0.38
18 0.3
19 0.3
20 0.24
21 0.25
22 0.25
23 0.24
24 0.22
25 0.2
26 0.18
27 0.13
28 0.13
29 0.09
30 0.09
31 0.07
32 0.07
33 0.08
34 0.1
35 0.11
36 0.13
37 0.16
38 0.18
39 0.18
40 0.19
41 0.19
42 0.17
43 0.2
44 0.18
45 0.18
46 0.18
47 0.19
48 0.23
49 0.26
50 0.28
51 0.24
52 0.23
53 0.21
54 0.19
55 0.19
56 0.15
57 0.11
58 0.1
59 0.09
60 0.12
61 0.15
62 0.15
63 0.14
64 0.13
65 0.13
66 0.15
67 0.18
68 0.23
69 0.24
70 0.25
71 0.29
72 0.3
73 0.32
74 0.36
75 0.4
76 0.39