Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RPI9

Protein Details
Accession A0A0H2RPI9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKTPWKLSRTRKANQRDRLKKVDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 10.333, cyto 5.5, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTQANLGGLLWKTPWKLSRTRKANQRDRLKKVDDVIETVRASGVQCSALAEALLLPKEHEMLPRDKYTTFSPHERGYRKGIHKVPKFTRLTLRTNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.15
5 0.16
6 0.19
7 0.23
8 0.24
9 0.34
10 0.43
11 0.52
12 0.58
13 0.64
14 0.69
15 0.75
16 0.81
17 0.81
18 0.82
19 0.82
20 0.81
21 0.81
22 0.75
23 0.67
24 0.61
25 0.57
26 0.46
27 0.4
28 0.34
29 0.31
30 0.27
31 0.23
32 0.2
33 0.14
34 0.13
35 0.1
36 0.09
37 0.05
38 0.05
39 0.06
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.07
51 0.07
52 0.1
53 0.13
54 0.16
55 0.2
56 0.22
57 0.24
58 0.23
59 0.26
60 0.26
61 0.3
62 0.31
63 0.32
64 0.34
65 0.39
66 0.46
67 0.47
68 0.47
69 0.46
70 0.51
71 0.51
72 0.56
73 0.58
74 0.61
75 0.65
76 0.72
77 0.72
78 0.73
79 0.71
80 0.66
81 0.69
82 0.65
83 0.65
84 0.64
85 0.68