Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2SNV3

Protein Details
Accession A0A0H2SNV3   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-80VQRRGHASSRRRKRDRTVRSKAPDBasic
NLS Segment(s)
PositionSequence
60-77RGHASSRRRKRDRTVRSK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, cyto 9, cyto_mito 5.333
Family & Domain DBs
Amino Acid Sequences MSNDLQYYTPSDNLNEHIALAHSQIFTEPSLGPYGYLPPPFDITSLLEDSCDGVQSVQRRGHASSRRRKRDRTVRSKAPDPIWKTTGPEDYMQVPDVSFPFSQTLPCLSTNDNTERTEVETQGSFPVDMGIELFGLKISVHMTFSVSETSANRSSGTLSSGFRRSIAIFLNSIADVLLPAGDHTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.19
4 0.17
5 0.16
6 0.15
7 0.15
8 0.15
9 0.11
10 0.11
11 0.11
12 0.12
13 0.11
14 0.13
15 0.12
16 0.1
17 0.13
18 0.13
19 0.12
20 0.12
21 0.16
22 0.17
23 0.18
24 0.18
25 0.17
26 0.21
27 0.2
28 0.2
29 0.17
30 0.16
31 0.18
32 0.18
33 0.17
34 0.13
35 0.13
36 0.14
37 0.12
38 0.11
39 0.07
40 0.06
41 0.09
42 0.12
43 0.17
44 0.18
45 0.21
46 0.22
47 0.25
48 0.33
49 0.39
50 0.46
51 0.51
52 0.6
53 0.68
54 0.73
55 0.76
56 0.79
57 0.81
58 0.82
59 0.83
60 0.81
61 0.8
62 0.8
63 0.79
64 0.74
65 0.68
66 0.64
67 0.58
68 0.53
69 0.46
70 0.4
71 0.36
72 0.34
73 0.31
74 0.26
75 0.22
76 0.18
77 0.17
78 0.17
79 0.16
80 0.13
81 0.1
82 0.09
83 0.09
84 0.1
85 0.08
86 0.08
87 0.09
88 0.09
89 0.09
90 0.09
91 0.11
92 0.11
93 0.12
94 0.13
95 0.12
96 0.14
97 0.18
98 0.21
99 0.22
100 0.21
101 0.21
102 0.2
103 0.22
104 0.22
105 0.19
106 0.17
107 0.14
108 0.14
109 0.14
110 0.14
111 0.1
112 0.08
113 0.09
114 0.07
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.06
127 0.07
128 0.07
129 0.08
130 0.09
131 0.1
132 0.11
133 0.1
134 0.11
135 0.11
136 0.17
137 0.18
138 0.18
139 0.18
140 0.17
141 0.18
142 0.18
143 0.19
144 0.17
145 0.16
146 0.21
147 0.24
148 0.24
149 0.22
150 0.24
151 0.22
152 0.23
153 0.25
154 0.22
155 0.19
156 0.19
157 0.21
158 0.19
159 0.18
160 0.14
161 0.1
162 0.07
163 0.07
164 0.06
165 0.04
166 0.05