Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RWA9

Protein Details
Accession A0A0H2RWA9    Localization Confidence High Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-127AAQASKPTRQRKTAKKGQEKSTTQHydrophilic
176-199EPHDTAPPAKRRRRRNLTETPAPSHydrophilic
399-431PKSYPFKLCSDCRKKQKLKKKMGEMKRRLKLVGHydrophilic
NLS Segment(s)
PositionSequence
184-190AKRRRRR
411-436RKKQKLKKKMGEMKRRLKLVGSASGK
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEHGGLQWLTFNPPATYKTPESSLQHAITPPDANIRTASASASSSEPTGPVDSASLVNEPSQQTPSAEPPAVVPPARSEAALFATTPLSFPTPDVSGTTGSASAAQASKPTRQRKTAKKGQEKSTTQPPMQVEPSVAPTPSDMPAPQGPQGQNVWIAPAGYPIRGPTFSVGAQPAEPHDTAPPAKRRRRRNLTETPAPSTSAVPPPPANLQHLPTVPPPPPPGYPYGYGGYPPPYPPHYIPPSGSHWYPGYPPPPHHGHVPPPVGYDVRGQHPYQFQYPYMPPPPQNGAYHWAPGQVPPPPAPVPPPAYAPDRSLEASGVPAPSASASSSAVQHDEPEVDLPQPDDEPMQPQENNRSPPINHNASPNGSLAQDNLDSTTKSSKAAKKICGSSTCALVLPKSYPFKLCSDCRKKQKLKKKMGEMKRRLKLVGSASGKPKSIGSAQPATADSDVDAEGDIDMDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.32
4 0.32
5 0.34
6 0.36
7 0.41
8 0.42
9 0.43
10 0.47
11 0.42
12 0.41
13 0.39
14 0.37
15 0.34
16 0.31
17 0.26
18 0.28
19 0.28
20 0.26
21 0.25
22 0.25
23 0.23
24 0.22
25 0.22
26 0.15
27 0.15
28 0.15
29 0.16
30 0.15
31 0.14
32 0.14
33 0.13
34 0.14
35 0.15
36 0.13
37 0.12
38 0.12
39 0.12
40 0.13
41 0.14
42 0.13
43 0.11
44 0.12
45 0.16
46 0.17
47 0.18
48 0.19
49 0.19
50 0.19
51 0.22
52 0.26
53 0.27
54 0.26
55 0.24
56 0.24
57 0.27
58 0.29
59 0.26
60 0.22
61 0.19
62 0.24
63 0.24
64 0.22
65 0.18
66 0.16
67 0.19
68 0.19
69 0.16
70 0.12
71 0.13
72 0.13
73 0.13
74 0.12
75 0.11
76 0.1
77 0.11
78 0.13
79 0.12
80 0.13
81 0.14
82 0.14
83 0.14
84 0.14
85 0.15
86 0.12
87 0.11
88 0.11
89 0.1
90 0.1
91 0.1
92 0.09
93 0.13
94 0.15
95 0.23
96 0.3
97 0.4
98 0.44
99 0.52
100 0.62
101 0.68
102 0.76
103 0.79
104 0.81
105 0.83
106 0.85
107 0.85
108 0.86
109 0.8
110 0.75
111 0.76
112 0.71
113 0.6
114 0.57
115 0.5
116 0.44
117 0.42
118 0.36
119 0.27
120 0.22
121 0.27
122 0.22
123 0.2
124 0.15
125 0.14
126 0.16
127 0.15
128 0.16
129 0.1
130 0.13
131 0.16
132 0.18
133 0.19
134 0.23
135 0.22
136 0.24
137 0.25
138 0.22
139 0.21
140 0.19
141 0.17
142 0.12
143 0.12
144 0.09
145 0.13
146 0.12
147 0.11
148 0.11
149 0.11
150 0.13
151 0.13
152 0.14
153 0.1
154 0.12
155 0.12
156 0.14
157 0.14
158 0.13
159 0.13
160 0.12
161 0.12
162 0.13
163 0.13
164 0.11
165 0.11
166 0.13
167 0.15
168 0.21
169 0.29
170 0.35
171 0.44
172 0.51
173 0.61
174 0.69
175 0.78
176 0.8
177 0.81
178 0.82
179 0.82
180 0.84
181 0.76
182 0.7
183 0.6
184 0.52
185 0.43
186 0.34
187 0.27
188 0.23
189 0.2
190 0.18
191 0.17
192 0.17
193 0.2
194 0.2
195 0.22
196 0.19
197 0.2
198 0.21
199 0.22
200 0.22
201 0.21
202 0.22
203 0.19
204 0.2
205 0.2
206 0.2
207 0.2
208 0.2
209 0.22
210 0.21
211 0.22
212 0.22
213 0.21
214 0.18
215 0.18
216 0.17
217 0.16
218 0.14
219 0.13
220 0.12
221 0.13
222 0.16
223 0.17
224 0.23
225 0.24
226 0.25
227 0.26
228 0.28
229 0.31
230 0.31
231 0.3
232 0.25
233 0.21
234 0.21
235 0.21
236 0.21
237 0.21
238 0.21
239 0.22
240 0.25
241 0.29
242 0.3
243 0.32
244 0.31
245 0.32
246 0.37
247 0.38
248 0.33
249 0.3
250 0.3
251 0.26
252 0.24
253 0.22
254 0.17
255 0.18
256 0.21
257 0.19
258 0.22
259 0.26
260 0.27
261 0.26
262 0.26
263 0.23
264 0.24
265 0.26
266 0.28
267 0.28
268 0.28
269 0.26
270 0.28
271 0.32
272 0.31
273 0.31
274 0.27
275 0.29
276 0.27
277 0.28
278 0.24
279 0.22
280 0.18
281 0.18
282 0.18
283 0.17
284 0.18
285 0.17
286 0.21
287 0.2
288 0.2
289 0.22
290 0.24
291 0.24
292 0.24
293 0.26
294 0.24
295 0.27
296 0.28
297 0.27
298 0.24
299 0.22
300 0.21
301 0.19
302 0.16
303 0.13
304 0.13
305 0.12
306 0.11
307 0.09
308 0.08
309 0.07
310 0.07
311 0.08
312 0.06
313 0.06
314 0.08
315 0.09
316 0.11
317 0.11
318 0.13
319 0.12
320 0.12
321 0.12
322 0.11
323 0.11
324 0.11
325 0.11
326 0.1
327 0.1
328 0.1
329 0.1
330 0.1
331 0.1
332 0.1
333 0.1
334 0.13
335 0.16
336 0.19
337 0.2
338 0.22
339 0.31
340 0.36
341 0.39
342 0.38
343 0.4
344 0.37
345 0.44
346 0.49
347 0.46
348 0.42
349 0.43
350 0.44
351 0.43
352 0.43
353 0.36
354 0.29
355 0.23
356 0.21
357 0.17
358 0.15
359 0.13
360 0.12
361 0.13
362 0.14
363 0.13
364 0.15
365 0.19
366 0.17
367 0.19
368 0.27
369 0.32
370 0.4
371 0.47
372 0.53
373 0.56
374 0.61
375 0.65
376 0.61
377 0.6
378 0.52
379 0.48
380 0.42
381 0.36
382 0.3
383 0.24
384 0.23
385 0.19
386 0.24
387 0.26
388 0.26
389 0.28
390 0.3
391 0.35
392 0.4
393 0.46
394 0.5
395 0.56
396 0.64
397 0.71
398 0.8
399 0.85
400 0.88
401 0.91
402 0.91
403 0.92
404 0.92
405 0.93
406 0.92
407 0.92
408 0.93
409 0.93
410 0.93
411 0.89
412 0.82
413 0.72
414 0.64
415 0.6
416 0.55
417 0.54
418 0.49
419 0.47
420 0.5
421 0.53
422 0.51
423 0.45
424 0.4
425 0.34
426 0.34
427 0.34
428 0.34
429 0.37
430 0.37
431 0.39
432 0.39
433 0.38
434 0.33
435 0.28
436 0.21
437 0.16
438 0.15
439 0.12
440 0.11
441 0.08
442 0.08