Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RRR9

Protein Details
Accession A0A0H2RRR9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-129VRSSTVSKQRRSRQSVWKEPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR008828  Sin1/Avo1  
IPR031313  Sin1_PH_dom  
Gene Ontology GO:0031932  C:TORC2 complex  
Pfam View protein in Pfam  
PF16979  SIN1_PH  
Amino Acid Sequences MQVIAAYKRYTVYRKVPMLVARLVRTLAIDGDYIHIMPSANKAKGVFDSGKTYSYHIKSVHSVQKSKGSANFKLVFRRDMGDKRYDFEAESPAAANEIVTNIRSVKASLVRSSTVSKQRRSRQSVWKEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.5
4 0.49
5 0.49
6 0.47
7 0.42
8 0.35
9 0.32
10 0.3
11 0.25
12 0.22
13 0.18
14 0.14
15 0.1
16 0.09
17 0.08
18 0.09
19 0.1
20 0.09
21 0.08
22 0.08
23 0.07
24 0.07
25 0.14
26 0.17
27 0.17
28 0.19
29 0.19
30 0.19
31 0.2
32 0.25
33 0.2
34 0.16
35 0.21
36 0.21
37 0.22
38 0.22
39 0.22
40 0.24
41 0.24
42 0.26
43 0.22
44 0.22
45 0.23
46 0.29
47 0.33
48 0.31
49 0.31
50 0.29
51 0.35
52 0.35
53 0.34
54 0.34
55 0.32
56 0.3
57 0.35
58 0.38
59 0.32
60 0.38
61 0.38
62 0.33
63 0.29
64 0.3
65 0.28
66 0.28
67 0.3
68 0.31
69 0.3
70 0.31
71 0.32
72 0.31
73 0.27
74 0.22
75 0.22
76 0.15
77 0.15
78 0.13
79 0.11
80 0.11
81 0.1
82 0.09
83 0.05
84 0.06
85 0.07
86 0.06
87 0.08
88 0.08
89 0.09
90 0.1
91 0.1
92 0.13
93 0.19
94 0.21
95 0.24
96 0.26
97 0.27
98 0.29
99 0.33
100 0.37
101 0.4
102 0.45
103 0.5
104 0.57
105 0.65
106 0.74
107 0.78
108 0.79
109 0.8