Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RX32

Protein Details
Accession A0A0H2RX32    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-53TPPVPIKRWSNIRRRTNRNTTYPRGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 6.5, cyto_nucl 4.5, extr 4, plas 3, nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPIVVTRISTIIGAWTLDIITLHICFATPPVPIKRWSNIRRRTNRNTTYPRGSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.04
13 0.05
14 0.06
15 0.06
16 0.1
17 0.13
18 0.15
19 0.18
20 0.22
21 0.27
22 0.37
23 0.45
24 0.51
25 0.58
26 0.67
27 0.75
28 0.81
29 0.85
30 0.85
31 0.85
32 0.85
33 0.84
34 0.81
35 0.8