Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RE01

Protein Details
Accession A0A0H2RE01    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RVPGHLKNRPTRRPSPPAKRRPVISBasic
NLS Segment(s)
PositionSequence
11-26KNRPTRRPSPPAKRRP
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MRWIRVPGHLKNRPTRRPSPPAKRRPVISQEPRTFAARRSNIVNMDYQRPVGRHLPAPSTPRNPAVAVSTSPNCAHHFRRTTSLAACPTRSPSSHGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.77
4 0.79
5 0.83
6 0.84
7 0.85
8 0.86
9 0.87
10 0.84
11 0.78
12 0.76
13 0.74
14 0.73
15 0.72
16 0.72
17 0.66
18 0.64
19 0.63
20 0.58
21 0.5
22 0.43
23 0.43
24 0.34
25 0.32
26 0.32
27 0.33
28 0.31
29 0.31
30 0.31
31 0.23
32 0.24
33 0.23
34 0.2
35 0.19
36 0.17
37 0.19
38 0.18
39 0.18
40 0.19
41 0.2
42 0.23
43 0.26
44 0.3
45 0.33
46 0.34
47 0.34
48 0.32
49 0.33
50 0.29
51 0.26
52 0.24
53 0.21
54 0.18
55 0.2
56 0.19
57 0.2
58 0.2
59 0.22
60 0.22
61 0.25
62 0.28
63 0.33
64 0.38
65 0.38
66 0.44
67 0.45
68 0.46
69 0.44
70 0.46
71 0.45
72 0.43
73 0.42
74 0.37
75 0.4
76 0.41
77 0.39