Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R2C9

Protein Details
Accession A0A0H2R2C9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-98AKGVEACKSRWQRKAKPWRKKTFPLYDDHydrophilic
NLS Segment(s)
PositionSequence
83-90RKAKPWRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPDPGDTTASEKVKNAKKETQWTSSDEALLVAKLVKARDDGLQADSGWKPVTWTIVVEALAGSEDVSGGIAKGVEACKSRWQRKAKPWRKKTFPLYDDLASLVDGIVATGEGAFRPGREKSHTPGNVETPTPTEPSPSSPRTTNDEDIHPSLRDTTMSDDEQLELDADPDADADSEPEMSAGKKVHRDASAGNATTKTKSQKRRSRTSGSAAMLALSGSLDAVTEAFKESADTPAAGILTTPQRRTAAIQAIEESEDLSDEEMLDAVELFREKPDVADAYMAIKKKPLRTAYLKRTLSRYTPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.54
4 0.59
5 0.68
6 0.72
7 0.7
8 0.66
9 0.62
10 0.6
11 0.53
12 0.46
13 0.35
14 0.29
15 0.22
16 0.19
17 0.15
18 0.1
19 0.1
20 0.11
21 0.12
22 0.12
23 0.13
24 0.15
25 0.17
26 0.2
27 0.2
28 0.2
29 0.21
30 0.2
31 0.22
32 0.21
33 0.2
34 0.17
35 0.15
36 0.14
37 0.14
38 0.17
39 0.13
40 0.14
41 0.14
42 0.16
43 0.16
44 0.14
45 0.13
46 0.1
47 0.09
48 0.08
49 0.07
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.06
60 0.07
61 0.1
62 0.12
63 0.14
64 0.23
65 0.32
66 0.4
67 0.46
68 0.55
69 0.62
70 0.71
71 0.81
72 0.82
73 0.84
74 0.88
75 0.9
76 0.89
77 0.89
78 0.87
79 0.87
80 0.78
81 0.72
82 0.65
83 0.56
84 0.47
85 0.39
86 0.29
87 0.18
88 0.16
89 0.1
90 0.06
91 0.05
92 0.04
93 0.03
94 0.03
95 0.03
96 0.02
97 0.03
98 0.02
99 0.04
100 0.04
101 0.05
102 0.08
103 0.09
104 0.12
105 0.18
106 0.21
107 0.23
108 0.33
109 0.36
110 0.36
111 0.37
112 0.38
113 0.34
114 0.32
115 0.29
116 0.22
117 0.2
118 0.19
119 0.16
120 0.14
121 0.13
122 0.18
123 0.23
124 0.23
125 0.24
126 0.25
127 0.27
128 0.31
129 0.36
130 0.35
131 0.31
132 0.31
133 0.31
134 0.31
135 0.3
136 0.24
137 0.19
138 0.15
139 0.14
140 0.12
141 0.09
142 0.11
143 0.12
144 0.13
145 0.13
146 0.13
147 0.13
148 0.13
149 0.12
150 0.09
151 0.06
152 0.06
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.05
167 0.07
168 0.08
169 0.11
170 0.15
171 0.17
172 0.21
173 0.22
174 0.23
175 0.22
176 0.28
177 0.31
178 0.27
179 0.27
180 0.24
181 0.24
182 0.24
183 0.26
184 0.27
185 0.3
186 0.39
187 0.49
188 0.56
189 0.64
190 0.73
191 0.78
192 0.79
193 0.76
194 0.73
195 0.7
196 0.63
197 0.56
198 0.45
199 0.38
200 0.29
201 0.22
202 0.15
203 0.07
204 0.05
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.04
212 0.05
213 0.06
214 0.06
215 0.07
216 0.08
217 0.11
218 0.11
219 0.11
220 0.1
221 0.11
222 0.11
223 0.09
224 0.08
225 0.09
226 0.17
227 0.21
228 0.21
229 0.23
230 0.25
231 0.26
232 0.29
233 0.33
234 0.33
235 0.32
236 0.32
237 0.31
238 0.31
239 0.3
240 0.27
241 0.2
242 0.11
243 0.09
244 0.08
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.05
251 0.05
252 0.05
253 0.04
254 0.06
255 0.06
256 0.07
257 0.07
258 0.09
259 0.09
260 0.1
261 0.14
262 0.15
263 0.15
264 0.16
265 0.16
266 0.19
267 0.23
268 0.24
269 0.2
270 0.24
271 0.28
272 0.33
273 0.41
274 0.42
275 0.46
276 0.56
277 0.66
278 0.71
279 0.77
280 0.76
281 0.71
282 0.72
283 0.7