Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2SBM4

Protein Details
Accession A0A0H2SBM4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-27RLYSKGRVLGHKRGKRNSRPNTSLVHydrophilic
NLS Segment(s)
PositionSequence
14-18KRGKR
Subcellular Location(s) mito 12.5, mito_nucl 11, nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences SSRLYSKGRVLGHKRGKRNSRPNTSLVQIEGVTTKDEAQFYLGKRVAFVYKAEREIRGSKVRVIWGRVTRPHGNSGVVKSKFASNLPPHAFGASVRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.81
4 0.82
5 0.86
6 0.86
7 0.85
8 0.82
9 0.77
10 0.71
11 0.63
12 0.54
13 0.44
14 0.36
15 0.25
16 0.21
17 0.18
18 0.14
19 0.12
20 0.1
21 0.11
22 0.1
23 0.1
24 0.1
25 0.11
26 0.14
27 0.14
28 0.21
29 0.22
30 0.2
31 0.2
32 0.21
33 0.2
34 0.18
35 0.18
36 0.17
37 0.17
38 0.21
39 0.22
40 0.21
41 0.23
42 0.25
43 0.29
44 0.29
45 0.27
46 0.26
47 0.27
48 0.32
49 0.31
50 0.32
51 0.33
52 0.33
53 0.37
54 0.39
55 0.43
56 0.43
57 0.43
58 0.44
59 0.39
60 0.37
61 0.34
62 0.35
63 0.38
64 0.34
65 0.32
66 0.3
67 0.31
68 0.3
69 0.28
70 0.31
71 0.26
72 0.35
73 0.38
74 0.4
75 0.38
76 0.36
77 0.35
78 0.27
79 0.27
80 0.19
81 0.16
82 0.13
83 0.13
84 0.13