FuNGI

Q6BMV4

Protein Details

Accession

Q6BMV4

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
5-53	LSSSEDYHKQRKRLNKRLLKLRHELDLITPDTKDYKKKEKISKISSSDY	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 21.5, cyto_nucl 13.5, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR026258 SRP68 IPR034652 SRP68-RBD IPR038253 SRP68_N_sf
Gene Ontology	GO:0005783 C:endoplasmic reticulum GO:0005730 C:nucleolus GO:0005786 C:signal recognition particle, endoplasmic reticulum targeting GO:0008312 F:7S RNA binding GO:0030942 F:endoplasmic reticulum signal peptide binding GO:0005047 F:signal recognition particle binding GO:0006614 P:SRP-dependent cotranslational protein targeting to membrane
KEGG	dha:DEHA2F02354g -
Pfam	View protein in Pfam PF16969 SRP68
CDD	cd15481 SRP68-RBD

Amino Acid Sequences

MSAYLSSSEDYHKQRKRLNKRLLKLRHELDLITPDTKDYKKKEKISKISSSDYDQDEKYGLLLLLTAERDSLYSSEIKSLLEISNDNASSYRNLMISRIKKSLSSSKKLLEITVNEKDEYKRIEYYTYAALIQGNLSVNKKQWSKALNAFSIAKCALDFLYSQEDSKMDIEEEQEESTQFKKTLISEITETLVDPSLALAISQDDTAYSTTTDLKTVSRQHCRDNKLSYLQPVIEIIARIDPEAVSEVSSSTELIKSVQWRDHEATLYNDELAYKIMKLTNDNETNWKNFNDANQFDVLLSGWSELLEIHTNDMDKNKDEDDLEKVQDRAIVLTYINFNLLFTRLKRDLLIIDQLSSQGDNVFALKKLEFNKDIIRLYGTIITTTQEIKDLPGVYNDEDLHESLDNLEKFFVAKKSAVLARSFALNNKFPEALKIFDHVDNTLSSSDNKFYKIDEFPYNVSSNVEFEKFKKELPSQVLQAQILAQFSVDLSKNLNQSNFVIENMNKYPVSNETLDNIANFNKNLSIAPVLSKPVLFDIGFNYINYGMGRSSSYNNSNSATSTTSDSTTDQNDPNKKKSGFFGIFGRS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.69
3	0.76
4	0.8
5	0.83
6	0.83
7	0.86
8	0.89
9	0.92
10	0.89
11	0.87
12	0.8
13	0.75
14	0.66
15	0.57
16	0.5
17	0.46
18	0.41
19	0.33
20	0.3
21	0.25
22	0.28
23	0.32
24	0.36
25	0.37
26	0.45
27	0.53
28	0.63
29	0.72
30	0.77
31	0.84
32	0.84
33	0.87
34	0.82
35	0.79
36	0.73
37	0.67
38	0.62
39	0.56
40	0.51
41	0.41
42	0.36
43	0.3
44	0.26
45	0.21
46	0.18
47	0.13
48	0.09
49	0.09
50	0.09
51	0.1
52	0.11
53	0.11
54	0.09
55	0.09
56	0.09
57	0.11
58	0.1
59	0.1
60	0.12
61	0.13
62	0.16
63	0.17
64	0.16
65	0.15
66	0.18
67	0.16
68	0.16
69	0.16
70	0.15
71	0.2
72	0.2
73	0.2
74	0.18
75	0.18
76	0.18
77	0.19
78	0.19
79	0.14
80	0.14
81	0.18
82	0.27
83	0.32
84	0.35
85	0.38
86	0.36
87	0.37
88	0.42
89	0.49
90	0.49
91	0.5
92	0.49
93	0.49
94	0.54
95	0.52
96	0.49
97	0.44
98	0.39
99	0.39
100	0.42
101	0.4
102	0.35
103	0.36
104	0.36
105	0.35
106	0.34
107	0.3
108	0.26
109	0.25
110	0.27
111	0.26
112	0.27
113	0.25
114	0.23
115	0.19
116	0.16
117	0.15
118	0.13
119	0.12
120	0.12
121	0.11
122	0.12
123	0.14
124	0.15
125	0.18
126	0.24
127	0.26
128	0.26
129	0.3
130	0.31
131	0.35
132	0.41
133	0.45
134	0.4
135	0.41
136	0.43
137	0.37
138	0.37
139	0.31
140	0.23
141	0.16
142	0.16
143	0.12
144	0.1
145	0.1
146	0.09
147	0.15
148	0.15
149	0.16
150	0.16
151	0.16
152	0.17
153	0.17
154	0.15
155	0.09
156	0.1
157	0.11
158	0.12
159	0.13
160	0.12
161	0.11
162	0.11
163	0.12
164	0.12
165	0.13
166	0.12
167	0.11
168	0.13
169	0.13
170	0.2
171	0.2
172	0.21
173	0.21
174	0.21
175	0.22
176	0.19
177	0.18
178	0.13
179	0.12
180	0.09
181	0.07
182	0.06
183	0.05
184	0.05
185	0.05
186	0.04
187	0.04
188	0.05
189	0.05
190	0.05
191	0.04
192	0.06
193	0.06
194	0.07
195	0.06
196	0.06
197	0.09
198	0.1
199	0.1
200	0.1
201	0.11
202	0.15
203	0.24
204	0.3
205	0.37
206	0.39
207	0.47
208	0.54
209	0.59
210	0.6
211	0.56
212	0.53
213	0.49
214	0.49
215	0.43
216	0.38
217	0.32
218	0.26
219	0.22
220	0.18
221	0.13
222	0.11
223	0.09
224	0.08
225	0.08
226	0.07
227	0.07
228	0.06
229	0.06
230	0.08
231	0.07
232	0.06
233	0.06
234	0.06
235	0.07
236	0.07
237	0.07
238	0.06
239	0.06
240	0.06
241	0.07
242	0.08
243	0.11
244	0.14
245	0.17
246	0.17
247	0.21
248	0.24
249	0.25
250	0.24
251	0.22
252	0.21
253	0.2
254	0.19
255	0.15
256	0.12
257	0.1
258	0.1
259	0.09
260	0.07
261	0.05
262	0.06
263	0.08
264	0.08
265	0.1
266	0.12
267	0.19
268	0.21
269	0.22
270	0.26
271	0.26
272	0.28
273	0.28
274	0.26
275	0.2
276	0.18
277	0.21
278	0.22
279	0.21
280	0.21
281	0.19
282	0.19
283	0.17
284	0.17
285	0.13
286	0.06
287	0.06
288	0.04
289	0.04
290	0.04
291	0.04
292	0.04
293	0.05
294	0.06
295	0.06
296	0.07
297	0.07
298	0.08
299	0.08
300	0.11
301	0.11
302	0.11
303	0.12
304	0.12
305	0.13
306	0.13
307	0.14
308	0.17
309	0.18
310	0.18
311	0.18
312	0.17
313	0.16
314	0.17
315	0.16
316	0.11
317	0.09
318	0.09
319	0.07
320	0.08
321	0.09
322	0.08
323	0.08
324	0.07
325	0.07
326	0.07
327	0.08
328	0.09
329	0.09
330	0.16
331	0.16
332	0.17
333	0.17
334	0.18
335	0.18
336	0.18
337	0.22
338	0.16
339	0.16
340	0.15
341	0.15
342	0.14
343	0.13
344	0.11
345	0.06
346	0.05
347	0.05
348	0.06
349	0.06
350	0.07
351	0.08
352	0.08
353	0.12
354	0.15
355	0.2
356	0.2
357	0.22
358	0.26
359	0.29
360	0.3
361	0.26
362	0.24
363	0.2
364	0.2
365	0.21
366	0.16
367	0.12
368	0.12
369	0.12
370	0.11
371	0.12
372	0.11
373	0.09
374	0.09
375	0.09
376	0.12
377	0.12
378	0.12
379	0.13
380	0.15
381	0.15
382	0.17
383	0.16
384	0.15
385	0.14
386	0.14
387	0.13
388	0.12
389	0.11
390	0.09
391	0.15
392	0.13
393	0.13
394	0.13
395	0.11
396	0.12
397	0.15
398	0.16
399	0.13
400	0.13
401	0.14
402	0.18
403	0.21
404	0.23
405	0.21
406	0.21
407	0.19
408	0.22
409	0.22
410	0.21
411	0.23
412	0.25
413	0.26
414	0.27
415	0.27
416	0.24
417	0.28
418	0.27
419	0.24
420	0.21
421	0.22
422	0.22
423	0.23
424	0.24
425	0.19
426	0.18
427	0.16
428	0.16
429	0.15
430	0.13
431	0.13
432	0.14
433	0.17
434	0.18
435	0.19
436	0.18
437	0.19
438	0.23
439	0.24
440	0.27
441	0.28
442	0.29
443	0.29
444	0.33
445	0.32
446	0.28
447	0.26
448	0.22
449	0.19
450	0.19
451	0.19
452	0.16
453	0.17
454	0.24
455	0.23
456	0.25
457	0.3
458	0.31
459	0.36
460	0.41
461	0.44
462	0.4
463	0.43
464	0.44
465	0.37
466	0.34
467	0.28
468	0.23
469	0.18
470	0.15
471	0.11
472	0.08
473	0.08
474	0.11
475	0.11
476	0.1
477	0.13
478	0.17
479	0.21
480	0.24
481	0.25
482	0.23
483	0.24
484	0.29
485	0.27
486	0.24
487	0.24
488	0.22
489	0.27
490	0.27
491	0.3
492	0.24
493	0.23
494	0.24
495	0.23
496	0.27
497	0.23
498	0.22
499	0.2
500	0.23
501	0.23
502	0.22
503	0.2
504	0.18
505	0.19
506	0.18
507	0.16
508	0.15
509	0.16
510	0.15
511	0.16
512	0.16
513	0.14
514	0.17
515	0.18
516	0.2
517	0.2
518	0.2
519	0.18
520	0.17
521	0.2
522	0.17
523	0.15
524	0.16
525	0.21
526	0.22
527	0.21
528	0.2
529	0.17
530	0.19
531	0.18
532	0.16
533	0.11
534	0.11
535	0.13
536	0.14
537	0.18
538	0.23
539	0.28
540	0.29
541	0.32
542	0.33
543	0.32
544	0.31
545	0.29
546	0.24
547	0.21
548	0.23
549	0.22
550	0.21
551	0.22
552	0.22
553	0.23
554	0.26
555	0.29
556	0.3
557	0.37
558	0.46
559	0.51
560	0.55
561	0.61
562	0.59
563	0.57
564	0.58
565	0.6
566	0.54
567	0.51

Q6BMV4

3D AlphaFold-predicted Structure Viewer