Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RGQ4

Protein Details
Accession A0A0H2RGQ4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MRAGDRPKRPKKKSPAFKNGPDDKLBasic
NLS Segment(s)
PositionSequence
6-16RPKRPKKKSPA
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 11.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRAGDRPKRPKKKSPAFKNGPDDKLWGLIERCWAPSPSARPDIFQVIKELDEMWPELKPELSGGSVDGMSDGETEMFFDAPEKFSDASDTFYNALEILDQVSDGGSELSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.89
4 0.9
5 0.9
6 0.87
7 0.79
8 0.69
9 0.61
10 0.5
11 0.45
12 0.36
13 0.29
14 0.22
15 0.19
16 0.22
17 0.21
18 0.22
19 0.2
20 0.2
21 0.19
22 0.23
23 0.26
24 0.27
25 0.33
26 0.31
27 0.3
28 0.32
29 0.37
30 0.33
31 0.29
32 0.25
33 0.19
34 0.19
35 0.18
36 0.16
37 0.09
38 0.09
39 0.09
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.04
65 0.06
66 0.07
67 0.08
68 0.09
69 0.11
70 0.11
71 0.11
72 0.15
73 0.15
74 0.17
75 0.17
76 0.19
77 0.17
78 0.17
79 0.17
80 0.13
81 0.12
82 0.09
83 0.08
84 0.07
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05