Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2S3Y9

Protein Details
Accession A0A0H2S3Y9   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-43QQQTPRPPSLRPRFDRRRRLPPVVKNIKNRTTMHydrophilic
256-275KAKAPAKKTSSKKTDTKKAAHydrophilic
NLS Segment(s)
PositionSequence
19-62SLRPRFDRRRRLPPVVKNIKNRTTMSKASATKRGATKKAAAAKP
130-307KGPAGKVKLAPKVKAEAVKEHAKEEKTKKEPKVAEKAAPKPKAAKPKAKALASTSKENKRPAKATAAAPKAKPAAKKSSAAPKAKAATKSTAPTKKAPAAKPVKKAVAASKPVAKKAPAAKKAPAAKAKAPAKKTSSKKTDTKKAAAKSAASKPKKVAKTPASKSKPASTKPTSAAKP
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005819  H1/H5  
IPR005818  Histone_H1/H5_H15  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00538  Linker_histone  
PROSITE View protein in PROSITE  
PS51504  H15  
Amino Acid Sequences MVRSPPTSLSQQQTPRPPSLRPRFDRRRRLPPVVKNIKNRTTMSKASATKRGATKKAAAAKPAAAHPSWIDMIKECIVAHPDDARSGVSRPAIKKFVEDKYKIEMNAAATSQLARAIVSGAEKEILVLPKGPAGKVKLAPKVKAEAVKEHAKEEKTKKEPKVAEKAAPKPKAAKPKAKALASTSKENKRPAKATAAAPKAKPAAKKSSAAPKAKAATKSTAPTKKAPAAKPVKKAVAASKPVAKKAPAAKKAPAAKAKAPAKKTSSKKTDTKKAAAKSAASKPKKVAKTPASKSKPASTKPTSAAKPASTAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.62
4 0.63
5 0.65
6 0.69
7 0.72
8 0.69
9 0.75
10 0.78
11 0.85
12 0.9
13 0.88
14 0.88
15 0.87
16 0.9
17 0.89
18 0.88
19 0.88
20 0.88
21 0.87
22 0.86
23 0.86
24 0.83
25 0.79
26 0.72
27 0.69
28 0.65
29 0.61
30 0.56
31 0.56
32 0.55
33 0.53
34 0.59
35 0.53
36 0.52
37 0.56
38 0.59
39 0.55
40 0.53
41 0.53
42 0.52
43 0.6
44 0.56
45 0.51
46 0.45
47 0.43
48 0.41
49 0.39
50 0.34
51 0.25
52 0.23
53 0.21
54 0.22
55 0.2
56 0.18
57 0.16
58 0.13
59 0.17
60 0.16
61 0.17
62 0.13
63 0.14
64 0.15
65 0.14
66 0.15
67 0.15
68 0.15
69 0.14
70 0.15
71 0.14
72 0.14
73 0.14
74 0.16
75 0.16
76 0.21
77 0.23
78 0.28
79 0.31
80 0.29
81 0.34
82 0.37
83 0.41
84 0.45
85 0.45
86 0.42
87 0.44
88 0.47
89 0.41
90 0.36
91 0.3
92 0.24
93 0.23
94 0.2
95 0.15
96 0.12
97 0.12
98 0.11
99 0.09
100 0.07
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.11
117 0.12
118 0.11
119 0.12
120 0.14
121 0.17
122 0.21
123 0.26
124 0.31
125 0.34
126 0.36
127 0.35
128 0.36
129 0.34
130 0.34
131 0.31
132 0.27
133 0.28
134 0.33
135 0.32
136 0.31
137 0.32
138 0.29
139 0.34
140 0.36
141 0.4
142 0.41
143 0.49
144 0.49
145 0.53
146 0.57
147 0.57
148 0.62
149 0.55
150 0.54
151 0.53
152 0.59
153 0.6
154 0.57
155 0.51
156 0.48
157 0.5
158 0.54
159 0.54
160 0.54
161 0.49
162 0.56
163 0.63
164 0.57
165 0.54
166 0.48
167 0.51
168 0.45
169 0.5
170 0.47
171 0.47
172 0.5
173 0.56
174 0.57
175 0.53
176 0.52
177 0.47
178 0.48
179 0.45
180 0.46
181 0.48
182 0.49
183 0.47
184 0.44
185 0.44
186 0.41
187 0.4
188 0.38
189 0.34
190 0.37
191 0.37
192 0.39
193 0.41
194 0.47
195 0.53
196 0.53
197 0.5
198 0.47
199 0.48
200 0.51
201 0.5
202 0.43
203 0.39
204 0.38
205 0.42
206 0.45
207 0.47
208 0.45
209 0.45
210 0.48
211 0.5
212 0.54
213 0.52
214 0.53
215 0.57
216 0.6
217 0.64
218 0.64
219 0.61
220 0.55
221 0.55
222 0.53
223 0.51
224 0.48
225 0.44
226 0.46
227 0.45
228 0.46
229 0.47
230 0.4
231 0.37
232 0.42
233 0.49
234 0.49
235 0.51
236 0.52
237 0.57
238 0.63
239 0.65
240 0.62
241 0.57
242 0.54
243 0.59
244 0.64
245 0.63
246 0.6
247 0.59
248 0.59
249 0.63
250 0.67
251 0.68
252 0.69
253 0.69
254 0.74
255 0.76
256 0.8
257 0.79
258 0.8
259 0.77
260 0.74
261 0.74
262 0.69
263 0.64
264 0.61
265 0.63
266 0.64
267 0.6
268 0.59
269 0.58
270 0.63
271 0.66
272 0.64
273 0.65
274 0.64
275 0.71
276 0.76
277 0.8
278 0.78
279 0.77
280 0.76
281 0.75
282 0.74
283 0.69
284 0.7
285 0.65
286 0.65
287 0.65
288 0.69
289 0.63
290 0.6
291 0.6
292 0.52
293 0.52