Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2S541

Protein Details
Accession A0A0H2S541    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-111LSVRAKAPINCKKRRRRTTTIPQEREKVHydrophilic
NLS Segment(s)
PositionSequence
96-99KRRR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MRCARPQRRSLDSLNPSPFPTSTSRSPRASLNLLDRAYRTLLLVLLYFGVARPRKITLYVYQHKHQKPREPSIYMNTFVRASTLSVRAKAPINCKKRRRRTTTIPQEREKVRERDQEISYRAESREQRDNTSIVKVMNEFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.51
4 0.48
5 0.42
6 0.35
7 0.32
8 0.29
9 0.33
10 0.4
11 0.44
12 0.45
13 0.47
14 0.47
15 0.48
16 0.46
17 0.41
18 0.39
19 0.4
20 0.38
21 0.37
22 0.34
23 0.3
24 0.28
25 0.24
26 0.17
27 0.11
28 0.11
29 0.1
30 0.1
31 0.08
32 0.06
33 0.06
34 0.06
35 0.05
36 0.11
37 0.12
38 0.12
39 0.13
40 0.15
41 0.16
42 0.18
43 0.21
44 0.21
45 0.3
46 0.37
47 0.4
48 0.44
49 0.52
50 0.54
51 0.59
52 0.57
53 0.56
54 0.56
55 0.6
56 0.61
57 0.55
58 0.53
59 0.52
60 0.5
61 0.42
62 0.35
63 0.28
64 0.22
65 0.19
66 0.17
67 0.11
68 0.09
69 0.1
70 0.16
71 0.16
72 0.17
73 0.18
74 0.19
75 0.23
76 0.26
77 0.33
78 0.36
79 0.45
80 0.53
81 0.63
82 0.72
83 0.78
84 0.85
85 0.85
86 0.85
87 0.86
88 0.88
89 0.9
90 0.9
91 0.87
92 0.81
93 0.79
94 0.73
95 0.69
96 0.65
97 0.6
98 0.57
99 0.58
100 0.57
101 0.57
102 0.58
103 0.58
104 0.53
105 0.51
106 0.45
107 0.4
108 0.37
109 0.37
110 0.39
111 0.36
112 0.44
113 0.42
114 0.45
115 0.45
116 0.47
117 0.41
118 0.41
119 0.39
120 0.29
121 0.29