Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RE64

Protein Details
Accession A0A0H2RE64    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
153-179AEKEREMKEKEKREKEKAERKAKIRRSBasic
NLS Segment(s)
PositionSequence
156-179EREMKEKEKREKEKAERKAKIRRS
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023139  PBDC1-like_dom_sf  
IPR008476  PBDC1_metazoa/fungi  
Pfam View protein in Pfam  
PF04669  Polysacc_synt_4  
Amino Acid Sequences MSTIIDASQTQNAVEIEKQFAVKAVEHAQVYWNLLEKIEPKKLRLTKYDDEIFKHLGEAFPELMEEPYEKITKIDEDWMKSADGKKRWREYIETYKDKIQDYNFGSLIRTDAGDEYAEMNTIFVTRMQFYAFEIARNRLGLNDKAHEIAIAEAEKEREMKEKEKREKEKAERKAKIRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.19
5 0.19
6 0.16
7 0.18
8 0.18
9 0.17
10 0.19
11 0.2
12 0.22
13 0.22
14 0.23
15 0.23
16 0.22
17 0.23
18 0.2
19 0.18
20 0.14
21 0.14
22 0.16
23 0.18
24 0.22
25 0.3
26 0.31
27 0.3
28 0.4
29 0.46
30 0.49
31 0.51
32 0.54
33 0.5
34 0.55
35 0.6
36 0.53
37 0.5
38 0.48
39 0.43
40 0.35
41 0.3
42 0.24
43 0.17
44 0.16
45 0.14
46 0.11
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.08
53 0.07
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.11
61 0.17
62 0.17
63 0.19
64 0.2
65 0.2
66 0.2
67 0.21
68 0.24
69 0.23
70 0.28
71 0.33
72 0.39
73 0.43
74 0.46
75 0.46
76 0.46
77 0.48
78 0.52
79 0.53
80 0.51
81 0.47
82 0.48
83 0.48
84 0.44
85 0.39
86 0.29
87 0.28
88 0.25
89 0.27
90 0.24
91 0.22
92 0.21
93 0.19
94 0.19
95 0.12
96 0.09
97 0.07
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.06
107 0.05
108 0.06
109 0.06
110 0.05
111 0.07
112 0.08
113 0.08
114 0.09
115 0.09
116 0.1
117 0.16
118 0.15
119 0.17
120 0.19
121 0.21
122 0.22
123 0.22
124 0.21
125 0.18
126 0.22
127 0.24
128 0.25
129 0.26
130 0.26
131 0.26
132 0.26
133 0.23
134 0.19
135 0.15
136 0.13
137 0.11
138 0.1
139 0.1
140 0.11
141 0.12
142 0.13
143 0.13
144 0.18
145 0.22
146 0.3
147 0.39
148 0.49
149 0.59
150 0.69
151 0.77
152 0.79
153 0.86
154 0.88
155 0.89
156 0.89
157 0.89
158 0.87
159 0.87