Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RAN1

Protein Details
Accession A0A0H2RAN1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
39-58HPPLSSRRERARQRVWRMKRBasic
104-125ITTSSRARPRPPKASKPAPSLMHydrophilic
NLS Segment(s)
PositionSequence
50-50R
111-118RPRPPKAS
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MKRLLLLVVSMQVGKARPSSVIRRPTRPANLLLAFTRIHPPLSSRRERARQRVWRMKRLHPFGSNVRPLVRPLVRPLVLHLSPSIALLPPPSAHHSSPIHHLFITTSSRARPRPPKASKPAPSLMPRLINGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.16
5 0.21
6 0.29
7 0.35
8 0.45
9 0.49
10 0.54
11 0.58
12 0.63
13 0.65
14 0.61
15 0.55
16 0.52
17 0.49
18 0.45
19 0.4
20 0.34
21 0.26
22 0.24
23 0.25
24 0.18
25 0.17
26 0.15
27 0.18
28 0.25
29 0.33
30 0.38
31 0.39
32 0.47
33 0.56
34 0.63
35 0.69
36 0.7
37 0.72
38 0.76
39 0.81
40 0.79
41 0.79
42 0.77
43 0.77
44 0.75
45 0.71
46 0.66
47 0.58
48 0.55
49 0.53
50 0.54
51 0.48
52 0.39
53 0.35
54 0.3
55 0.28
56 0.3
57 0.25
58 0.19
59 0.2
60 0.25
61 0.25
62 0.24
63 0.26
64 0.26
65 0.24
66 0.24
67 0.2
68 0.15
69 0.14
70 0.15
71 0.13
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.09
78 0.13
79 0.16
80 0.17
81 0.22
82 0.24
83 0.25
84 0.33
85 0.33
86 0.3
87 0.27
88 0.27
89 0.22
90 0.23
91 0.26
92 0.2
93 0.19
94 0.22
95 0.28
96 0.31
97 0.4
98 0.46
99 0.51
100 0.6
101 0.67
102 0.74
103 0.78
104 0.85
105 0.84
106 0.82
107 0.78
108 0.75
109 0.71
110 0.66
111 0.62
112 0.56