Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R5D1

Protein Details
Accession A0A0H2R5D1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-33TPSSLGTRPPNKRQNPSARSRRHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, extr 11
Family & Domain DBs
Amino Acid Sequences MLVLRACLSFTPSSLGTRPPNKRQNPSARSRRHGAYGQNAEKNANDNHECHPGPPRAGDAVKVCFLPSRPAFTPVPRSHADQQVNREFRCQKSEGCLGHTTRLPPLPESQWGEGEGTDRQGWRHAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.3
4 0.39
5 0.47
6 0.53
7 0.62
8 0.67
9 0.73
10 0.77
11 0.8
12 0.79
13 0.81
14 0.81
15 0.8
16 0.77
17 0.74
18 0.67
19 0.61
20 0.58
21 0.53
22 0.52
23 0.53
24 0.53
25 0.51
26 0.49
27 0.44
28 0.4
29 0.38
30 0.29
31 0.25
32 0.21
33 0.19
34 0.22
35 0.27
36 0.27
37 0.24
38 0.29
39 0.26
40 0.25
41 0.24
42 0.22
43 0.19
44 0.19
45 0.2
46 0.17
47 0.16
48 0.16
49 0.16
50 0.14
51 0.12
52 0.13
53 0.16
54 0.15
55 0.19
56 0.19
57 0.23
58 0.24
59 0.26
60 0.35
61 0.3
62 0.34
63 0.31
64 0.35
65 0.35
66 0.42
67 0.45
68 0.4
69 0.46
70 0.5
71 0.52
72 0.48
73 0.49
74 0.45
75 0.42
76 0.44
77 0.39
78 0.31
79 0.33
80 0.4
81 0.35
82 0.36
83 0.39
84 0.34
85 0.36
86 0.37
87 0.32
88 0.29
89 0.32
90 0.29
91 0.26
92 0.29
93 0.28
94 0.33
95 0.37
96 0.35
97 0.32
98 0.31
99 0.3
100 0.26
101 0.25
102 0.19
103 0.17
104 0.17
105 0.17
106 0.17
107 0.21