Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2SBJ9

Protein Details
Accession A0A0H2SBJ9   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-30QASHRRLRRCSQPQTFCQNSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020003  ATPase_a/bsu_AS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0006811  P:monoatomic ion transport  
PROSITE View protein in PROSITE  
PS00152  ATPASE_ALPHA_BETA  
Amino Acid Sequences MDLLERVEAQASHRRLRRCSQPQTFCQNSRLRSKLQRQPDLRIPIEECLEPWRLTSQIPIKDGPFFVLALQAHQRALPPTTTISSRALSPSPLLPSMPTDGRRPLIGGRTVFSLRVRLNGAPNHQRERSESFFFRGRKLSALARSVDHFPPSVNPAVSGSRVESWGFGRSFSPSEPGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.55
4 0.62
5 0.63
6 0.7
7 0.72
8 0.75
9 0.77
10 0.82
11 0.82
12 0.74
13 0.72
14 0.68
15 0.63
16 0.63
17 0.59
18 0.56
19 0.58
20 0.65
21 0.65
22 0.68
23 0.73
24 0.68
25 0.71
26 0.73
27 0.71
28 0.63
29 0.57
30 0.49
31 0.41
32 0.39
33 0.32
34 0.24
35 0.19
36 0.21
37 0.18
38 0.17
39 0.16
40 0.15
41 0.15
42 0.2
43 0.24
44 0.25
45 0.27
46 0.28
47 0.27
48 0.28
49 0.28
50 0.23
51 0.17
52 0.13
53 0.11
54 0.13
55 0.12
56 0.12
57 0.14
58 0.13
59 0.12
60 0.12
61 0.13
62 0.11
63 0.12
64 0.1
65 0.09
66 0.1
67 0.11
68 0.12
69 0.13
70 0.14
71 0.14
72 0.14
73 0.14
74 0.13
75 0.12
76 0.12
77 0.12
78 0.11
79 0.11
80 0.1
81 0.09
82 0.1
83 0.12
84 0.14
85 0.15
86 0.15
87 0.17
88 0.18
89 0.17
90 0.17
91 0.17
92 0.18
93 0.2
94 0.19
95 0.17
96 0.2
97 0.2
98 0.2
99 0.19
100 0.2
101 0.16
102 0.18
103 0.2
104 0.18
105 0.23
106 0.25
107 0.31
108 0.34
109 0.39
110 0.42
111 0.42
112 0.41
113 0.41
114 0.44
115 0.43
116 0.41
117 0.38
118 0.36
119 0.42
120 0.42
121 0.41
122 0.38
123 0.33
124 0.3
125 0.31
126 0.34
127 0.32
128 0.34
129 0.33
130 0.3
131 0.32
132 0.34
133 0.32
134 0.28
135 0.22
136 0.19
137 0.21
138 0.23
139 0.24
140 0.2
141 0.19
142 0.2
143 0.23
144 0.23
145 0.22
146 0.2
147 0.18
148 0.19
149 0.19
150 0.18
151 0.18
152 0.22
153 0.21
154 0.2
155 0.19
156 0.21
157 0.23
158 0.23