Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2R6S5

Protein Details
Accession A0A0H2R6S5    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MELTDHKERPSKKRRPSSAGSCLPGKSRRPRSKTSQCHPHydrophilic
NLS Segment(s)
PositionSequence
8-19ERPSKKRRPSSA
24-31PGKSRRPR
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MELTDHKERPSKKRRPSSAGSCLPGKSRRPRSKTSQCHPPSPSNGDTDTMNNPIPTLEVLSSTPMCIGKVGGVAVLEKRAREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.84
4 0.83
5 0.83
6 0.79
7 0.72
8 0.64
9 0.56
10 0.53
11 0.5
12 0.48
13 0.48
14 0.53
15 0.59
16 0.63
17 0.68
18 0.73
19 0.78
20 0.8
21 0.76
22 0.76
23 0.69
24 0.7
25 0.68
26 0.62
27 0.55
28 0.51
29 0.46
30 0.37
31 0.35
32 0.28
33 0.25
34 0.22
35 0.2
36 0.17
37 0.16
38 0.14
39 0.13
40 0.12
41 0.11
42 0.09
43 0.09
44 0.07
45 0.08
46 0.08
47 0.11
48 0.12
49 0.11
50 0.12
51 0.11
52 0.11
53 0.1
54 0.1
55 0.08
56 0.09
57 0.09
58 0.08
59 0.08
60 0.09
61 0.1
62 0.16
63 0.16