Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2R520

Protein Details
Accession A0A0H2R520    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-35QTSNHHCKCGKKSQSEKSRRGHCKKCHEVCKGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, mito_nucl 13.166, cyto_nucl 12.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MPPQTSNHHCKCGKKSQSEKSRRGHCKKCHEVCKGTSEQKHDPWVMNKGDTCTRCENIAADKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.76
4 0.83
5 0.85
6 0.85
7 0.83
8 0.85
9 0.85
10 0.85
11 0.84
12 0.82
13 0.83
14 0.85
15 0.85
16 0.84
17 0.79
18 0.74
19 0.67
20 0.64
21 0.58
22 0.54
23 0.49
24 0.46
25 0.44
26 0.42
27 0.44
28 0.4
29 0.38
30 0.35
31 0.38
32 0.34
33 0.33
34 0.31
35 0.3
36 0.36
37 0.34
38 0.35
39 0.35
40 0.34
41 0.33
42 0.33
43 0.31
44 0.3