Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RHT3

Protein Details
Accession A0A0H2RHT3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-58GAIHCDRKSRRPVRPRKTPSLDMHydrophilic
NLS Segment(s)
PositionSequence
45-49RRPVR
Subcellular Location(s) nucl 10, plas 8, cyto 4, extr 2, mito 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MSTGSRSSGDGTYLSQVDSFINVSEDQAPFRHESIGAIHCDRKSRRPVRPRKTPSLDMPVGGLALCLACFLVLRGQKHCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.13
4 0.11
5 0.11
6 0.1
7 0.07
8 0.09
9 0.08
10 0.09
11 0.12
12 0.12
13 0.12
14 0.12
15 0.14
16 0.14
17 0.14
18 0.14
19 0.11
20 0.11
21 0.14
22 0.16
23 0.15
24 0.15
25 0.17
26 0.17
27 0.23
28 0.24
29 0.27
30 0.35
31 0.41
32 0.49
33 0.58
34 0.68
35 0.72
36 0.82
37 0.83
38 0.83
39 0.83
40 0.79
41 0.74
42 0.72
43 0.63
44 0.52
45 0.45
46 0.35
47 0.27
48 0.21
49 0.15
50 0.06
51 0.05
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.05
58 0.11
59 0.16
60 0.2