Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RK09

Protein Details
Accession A0A0H2RK09    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-72YEKLTKARRSCLNQFPNRRFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7cysk 7, cyto_nucl 6.5, mito 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027652  PRP8  
IPR019580  Prp8_U6-snRNA-bd  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0017070  F:U6 snRNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF10596  U6-snRNA_bdg  
Amino Acid Sequences MDVIAALGGVKGIIEHTLFKGSYSPTWEGEGFSVENLCLFWEKPTAFDESMTYEKLTKARRSCLNQFPNRRFTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.08
4 0.12
5 0.12
6 0.12
7 0.14
8 0.15
9 0.16
10 0.2
11 0.2
12 0.18
13 0.21
14 0.21
15 0.19
16 0.18
17 0.17
18 0.12
19 0.1
20 0.09
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.09
29 0.09
30 0.1
31 0.12
32 0.15
33 0.15
34 0.15
35 0.16
36 0.16
37 0.18
38 0.18
39 0.17
40 0.15
41 0.16
42 0.21
43 0.27
44 0.31
45 0.34
46 0.41
47 0.49
48 0.56
49 0.63
50 0.68
51 0.72
52 0.74
53 0.8
54 0.8