Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R2N7

Protein Details
Accession A0A0H2R2N7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKRGHLVSKKRNRKWNHKPSFSRELSRBasic
NLS Segment(s)
PositionSequence
9-16KKRNRKWN
Subcellular Location(s) mito 11, plas 6, cyto_mito 6, golg 4
Family & Domain DBs
Amino Acid Sequences MKRGHLVSKKRNRKWNHKPSFSRELSRYSRIGASRFVFSGGSIILTILLSPAPEGELEACRCDVRWTFISTNIDICSRVSYDRSEGPSHNKEDMCRSRHSSIATDGRRLDAVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.89
4 0.89
5 0.88
6 0.87
7 0.88
8 0.81
9 0.77
10 0.68
11 0.65
12 0.6
13 0.56
14 0.49
15 0.41
16 0.41
17 0.36
18 0.35
19 0.32
20 0.28
21 0.26
22 0.25
23 0.23
24 0.19
25 0.16
26 0.15
27 0.1
28 0.08
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.06
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.1
50 0.1
51 0.13
52 0.14
53 0.19
54 0.19
55 0.24
56 0.27
57 0.25
58 0.26
59 0.23
60 0.21
61 0.17
62 0.16
63 0.13
64 0.11
65 0.12
66 0.12
67 0.13
68 0.15
69 0.2
70 0.23
71 0.25
72 0.26
73 0.33
74 0.38
75 0.39
76 0.42
77 0.38
78 0.36
79 0.44
80 0.49
81 0.45
82 0.45
83 0.48
84 0.46
85 0.48
86 0.49
87 0.42
88 0.42
89 0.49
90 0.46
91 0.45
92 0.43
93 0.41
94 0.4