Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2S244

Protein Details
Accession A0A0H2S244    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNRKAHRNGIKSKPKQRTTSHydrophilic
NLS Segment(s)
PositionSequence
14-54RKAHRNGIKSKPKQRTTSLRGVDAKFRRNARFALVGSRKAR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKSKPKQRTTSLRGVDAKFRRNARFALVGSRKARAEEKAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.77
5 0.76
6 0.76
7 0.79
8 0.79
9 0.8
10 0.82
11 0.83
12 0.81
13 0.76
14 0.74
15 0.74
16 0.7
17 0.7
18 0.62
19 0.58
20 0.55
21 0.51
22 0.52
23 0.47
24 0.46
25 0.42
26 0.45
27 0.43
28 0.41
29 0.41
30 0.37
31 0.38
32 0.33
33 0.38
34 0.38
35 0.42
36 0.42
37 0.44
38 0.41
39 0.38
40 0.41
41 0.34
42 0.35